(data stored in ACNUC7421 zone)

EMBL: CP001958.PE295

CP001958.PE295       Location/Qualifiers
FT   CDS_pept        complement(273050..273634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0301"
FT                   /product="serine O-acetyltransferase"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   rer:RER_10920 serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96788"
FT                   /db_xref="GOA:D6ZB29"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB29"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ADG96788.1"
FT                   /translation="MSVLSALREDLQNARSHDPAARSDLENALLYSGLHAIWAYRVAHR
FT                   MWATPALRGPARALSQLARFFTGVEIHPGATIGRRFFIDHGMGVVIGETAEIGDDVMVY
FT                   HGVTLGGRSLRAGKRHPTIGNRVTVGAGAKVLGPLRIGDDSAVGANAVVTRDVPAESIA
FT                   TGIPAVVRSRTEKQREPGVDPTCYIDPALYI"
     gtgtccgtcc tgtccgcttt gcgcgaagac ttgcagaacg cgcgcagcca cgaccctgcc        60
     gcgcgcagcg acctggagaa cgcgctgctc tattccgggt tgcacgcgat ctgggcctac       120
     cgggtcgcgc accgcatgtg ggccacaccg gcgttgcgcg ggccagccag agcgctgtcc       180
     cagctcgccc ggttcttcac cggagtcgaa atacatccgg gggccacaat cggccgacgg       240
     ttcttcatcg accacggcat gggcgttgtg atcggggaaa ccgcggagat cggcgacgac       300
     gtcatggtgt accacggggt caccttgggc gggcggtcct tgcgggcagg caagcgccac       360
     cccaccatcg gcaaccgggt caccgtcggg gccggggcga aagtcctcgg gccgctgcgg       420
     atcggcgacg acagcgccgt cggggcgaat gccgtggtca cccgcgacgt gcccgccgaa       480
     tcgattgcga caggcatccc cgcggtcgtg cgttcgcgca ctgagaagca acgcgagccg       540
     ggggtcgacc cgacgtgcta catcgacccc gcgctgtata tctga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page