(data stored in ACNUC7421 zone)

EMBL: CP001958.PE297

CP001958.PE297       Location/Qualifiers
FT   CDS_pept        274825..275502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mav:MAV_1612 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96790"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB31"
FT                   /inference="similar to AA sequence:KEGG:MAV_1612"
FT                   /protein_id="ADG96790.1"
FT                   /translation="MDLQDERARAAPVIIADGLGVDGEHGPFFSDIRLALAPGLHAVRT
FT                   SGPPAQSVLLLTLAGRFKPSRGELSVRGDVEPGKIRRHCAIAAFADIDELEEAVTVRTV
FT                   LAEQRRWLAPWCSRAKAEPAAAVLGEVFAEIPPPPLAKYVADLSDLEVFLLRIALALVT
FT                   DRPILVVGDLEQVRDSAHRALAARRLGALAARRTVVVGVANPLGDDAPDHTLHDCRILL
FT                   RKD"
     atggacttgc aggacgagcg cgcccgcgcc gcgccggtca tcattgccga cggattgggc        60
     gtggacggcg agcacggccc gttcttctcc gacatccgcc ttgcgctcgc gccgggcttg       120
     cacgctgtgc ggacatccgg cccaccagcg cagagcgtgc tgctgctgac gctcgcggga       180
     cgtttcaagc cgagccgggg cgagctgtcc gtgcgcgggg acgtcgagcc ggggaaaatc       240
     cgacggcatt gcgcgatcgc ggctttcgcc gacatcgacg agttggagga ggcggtcacc       300
     gtgcggacag tgctcgccga gcagcggcga tggctggctc cgtggtgctc gcgggccaag       360
     gccgagcccg ccgcggcggt gctgggcgag gtgttcgccg agatcccccc gccgccgttg       420
     gcgaaatatg tcgccgacct ttccgacctt gaggtgttcc tgctcaggat cgctctcgcg       480
     ctcgtgacag accggccgat tctggtggtc ggcgacttgg agcaggtccg cgacagtgcg       540
     caccgggcgc tcgcggcccg ccgcctgggc gcgctcgccg cccggcggac cgtcgtcgtc       600
     ggggtggcca accccctcgg cgacgacgct cccgaccaca ctttgcacga ctgtcgcatt       660
     ctgctcagaa aggactga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page