(data stored in ACNUC7421 zone)

EMBL: CP001958.PE299

CP001958.PE299       Location/Qualifiers
FT   CDS_pept        complement(277356..278540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0305"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   nfa:nfa54750 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96792"
FT                   /db_xref="GOA:D6ZB33"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB33"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADG96792.1"
FT                   /translation="MAQLTQVLLLSWRDTTHPQGGGSEQYLERVGERLASEGVEVVVRT
FT                   ARHRGSARSETRDGMRFSRGGGRLTVYPRALAALALARIGIGPLAGFRPDVIVDTHNGM
FT                   GFFARLATRAPVVVLVHHCHKEQWPVAGRLLGALGWWLESVVSPWVHRRAQYLTVSLPS
FT                   LEGLVRLGVDRERAAVVRAGVDRVPAGAPVGGPATRSAQPTLCVLTRLVPHKRVEDVLD
FT                   ALAALRADGLAQLRLEIVGDGWWADNLRRRADELAVADAVVFHGRVDEARKHEVLARAW
FT                   LHVMPSLAEGWGLAVIEAAQHGVPTVGYTGSGGLTDSILDGVTGVLVDGPEDLARVVRD
FT                   LIGDHRQREALGEKARRRAREFSWAQTAAGVRQVLEAAARGELVSGLVGPANGR"
     atggctcagc ttacccaagt cctgctcttg agctggcggg ataccaccca tccgcagggc        60
     gggggcagcg agcagtactt ggagcgggtc ggcgaacggc tcgcgagcga gggcgtcgag       120
     gtggtcgtgc gcaccgcgcg ccaccgcggc tcggcgcgct ccgagacgcg cgacggcatg       180
     cggttctccc gaggcggcgg caggctcacg gtgtacccga gggcgctcgc cgcgctcgcc       240
     ttggccagga tcgggatcgg ccccctggcc ggattccgcc cggacgtcat tgtcgacacg       300
     cacaacggga tggggttttt cgcccggttg gccacccgcg cgccggtggt ggtgctcgtg       360
     caccactgcc acaaagagca gtggccggtg gctggccgcc tgctcggcgc gctcggctgg       420
     tggcttgagt ctgtcgtctc gccctgggtg caccgccgcg cccagtacct cactgtctcg       480
     ctcccgtctc tggagggcct ggtgcggctc ggcgtcgacc gggaacgcgc cgccgtggtc       540
     cgggccggag tcgaccgggt gcccgcaggc gcgcccgtcg gcggccccgc gactcgcagc       600
     gcgcagccga cattgtgcgt gctcacccgc ctcgtgccgc acaaacgggt ggaggacgtg       660
     ctggacgcgt tggcggcgct gcgcgcggac gggctcgcgc agttgcggct cgaaatcgtc       720
     ggggacggct ggtgggcgga caatttgcgc cgccgcgcgg acgagctcgc cgtcgcggac       780
     gctgtcgtgt tccacggccg cgtcgacgag gcgcgcaaac atgaagtcct cgcccgcgcc       840
     tggctgcacg tcatgccctc cctcgccgaa ggctgggggc tcgcggtgat cgaagcggcc       900
     cagcacggcg tgcccaccgt cgggtacacc ggcagcggcg ggctgaccga ctccatcctc       960
     gacggcgtca cgggggttct ggtcgacggg ccggaggacc tcgcccgcgt cgtgcgcgac      1020
     ctgatcggcg accaccggca acgcgaggcc ttgggcgaga aggcccgcag gcgggcgcgc      1080
     gagttcagct gggcccagac cgcggcgggc gtgcggcaag tccttgaggc ggcagcgcgc      1140
     ggcgaactgg tgtcgggtct ggtcggaccg gcgaacgggc gctga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page