(data stored in ACNUC7421 zone)

EMBL: CP001958.PE304

CP001958.PE304       Location/Qualifiers
FT   CDS_pept        282215..283735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0310"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa42710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96797"
FT                   /db_xref="InterPro:IPR026835"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96797.1"
FT                   /translation="MSPDPVLSVSPPDFSRAGQIVRSALGGGSSGSGGEIAPAFFDLVM
FT                   DLKTTKGLAGTDAYAHEWNNQFYRPALIGDTGGAGKGGGLMDAATVALNAMGMLSDLLV
FT                   YSGINHALGDDPDAPAFPPGTHEVIPVPFVPDAQGRTMQAAPGWWPIIAGMLTGQEYPD
FT                   GDVSALRNLRDRYKSTATAFRSGTAALDQASALVQQQQAPEVAGVVNWLGIVKTQLLDV
FT                   ADGFDVLGDGCAQFAQHVQSARDEVNKKAQEELGNIAETEIISAGLAGATLGVSEVLGN
FT                   YRLYKRAKELAEFVKTRLSAERIAQELRDAFSPMAAIAGGPAAQGVGKLLPLLNAMPAI
FT                   YMPEGAAEAAAIGSALGLDRLVTHMTRRMRPNAATERQVYENAVSESMNGKEYWQSGAN
FT                   KNILIPKDGKYPPEITNLPKTDNGKYYQGADGTLYPVNTQIHIGHIKYSEWARLRNDAI
FT                   AKGWTERQLQEYIQNHKLYQIEDAYGNLSHQYEAPIPSVAEILRENPQ"
     gtgagccccg atccggtttt gtcggtgtcc ccgcctgatt tcagccgcgc ggggcagatc        60
     gtgcgttccg cgttgggcgg gggctcctcg ggttctggcg gggagatcgc cccggcgttc       120
     ttcgacctgg tgatggactt gaagaccacg aaaggcctgg cgggcacgga cgcgtacgca       180
     cacgaatgga ataaccagtt ctaccggccc gctttgatcg gggacacggg cggcgcgggc       240
     aagggcggcg gcctgatgga cgcggcgacc gtcgcattga acgccatggg gatgctctcg       300
     gatctgctcg tgtactcggg gatcaaccac gcgctcgggg acgacccgga cgcgcccgcg       360
     ttcccaccgg gcacccacga ggtgatcccg gtgccgttcg tcccggacgc gcagggccgc       420
     acaatgcagg ccgcgccggg gtggtggccg atcatcgccg ggatgctcac cgggcaggag       480
     tacccggacg gggacgtgag cgcgctcaga aacctcaggg accgctacaa atccaccgcg       540
     accgcgttcc gcagcgggac agcggccctg gaccaagcat ccgcgctcgt gcagcagcag       600
     caagccccgg aggtcgctgg ggtggtgaac tggctgggga tcgtgaaaac ccagcttttg       660
     gacgtggcgg acgggttcga cgttctcggc gacggctgcg cgcagttcgc gcagcacgtc       720
     cagagcgcgc gcgacgaggt gaacaagaaa gcccaggaag agctggggaa catcgcggag       780
     acggagatca tctccgctgg cctggcgggg gccaccctcg gcgtctccga agtgctcggc       840
     aactaccggc tctacaagcg cgcgaaggag ctggccgagt tcgtcaaaac ccggttgagc       900
     gcagagcgca tcgcccaaga gctgcgtgac gcgttcagcc ccatggccgc aatcgcgggc       960
     ggcccagccg cccaaggcgt cggcaagctc ctcccgctgt tgaacgcgat gcccgccatc      1020
     tacatgcccg aaggcgccgc cgaagccgcc gccatcggct cagcgttagg cctcgaccgc      1080
     ctcgtcacgc acatgacgcg ccgcatgcgc cccaacgccg ccaccgaacg ccaggtgtac      1140
     gagaacgcgg tctctgagag catgaacggc aaggagtact ggcagagcgg cgcgaacaaa      1200
     aatatcctca tccccaagga cggcaaatac cccccggaga tcaccaacct tcccaaaacc      1260
     gacaacggga agtactacca aggcgcggac ggcacgctgt accctgtgaa cacgcaaatc      1320
     catatcggac acatcaagta cagcgaatgg gcgaggcttc gaaacgacgc tatagctaaa      1380
     ggctggaccg aacgccagct tcaggagtac attcagaacc acaagctcta tcagatcgag      1440
     gacgcgtacg gcaatctgag ccaccagtac gaggccccca tcccttccgt ggccgagatt      1500
     ttgagagaga acccgcaatg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page