(data stored in ACNUC7421 zone)

EMBL: CP001958.PE305

CP001958.PE305       Location/Qualifiers
FT   CDS_pept        283732..284289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0311"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: sin:YN1551_2013 ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96798"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB39"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ADG96798.1"
FT                   /translation="MTNNIDVHSRDSLQQTPLHISVGDMWEPGDRTPSVDQLIAAGADV
FT                   NARDQWGRTPLHYASHSDRADAVAALIAAGADVNARDNGNWTPLHAAAARGCTAVVKLL
FT                   LDAGAEVEPIDSQGETPLSRAITAKSGVPEEVIKLLRERGANPWRKSGRHSPLSAARAH
FT                   TSGYHFQEIKEAFADLPDEEPK"
     atgactaata acatcgacgt acacagccga gacagcttgc agcagacccc gttgcacatc        60
     agcgtcggtg acatgtggga accgggcgat cgtaccccgt cagtagatca gctcatcgca       120
     gccggggccg acgtgaacgc acgcgatcag tgggggcgta ccccgcttca ctacgccagc       180
     catagcgacc gagccgacgc ggtggcggcg cttatcgcag ctggtgccga tgtgaacgcc       240
     cgagacaacg gaaactggac cccactgcat gcagccgcag cccgaggctg cacagctgtg       300
     gtcaagttac tccttgacgc gggagccgaa gtggagccta ttgacagcca aggggagaca       360
     cctttgtcaa gagccatcac agcgaagagc ggtgtaccgg aagaagtgat caaactgctg       420
     cgtgagcgtg gtgctaatcc gtggcgtaag agcggtcggc acagccctct gagcgctgcc       480
     cgagcccaca cgagcggtta tcactttcag gagatcaaag aggcatttgc ggacttgccg       540
     gatgaggagc cgaagtga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page