(data stored in ACNUC7421 zone)

EMBL: CP001958.PE306

CP001958.PE306       Location/Qualifiers
FT   CDS_pept        284286..284726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ZNF692; zinc finger protein 692"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96799"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96799.1"
FT                   /translation="MSVLDTDGRLADMRVRAERFAARVEGIRGKGTRLNGRLVFEVDAR
FT                   KNPVNVAVDASIGQYNADSIAELFHGAARDACQDVDRQMREALVEFGEDQKTRELVREL
FT                   MGPLSPRLPPAPGAQQRQAEPQGPDPDDEEAWNDARSWLEKA"
     gtgagcgttc ttgacacgga tgggcggttg gcggacatgc gggttcgggc tgagcggttc        60
     gccgcgcggg tggaggggat tcggggcaag ggcactcgtt tgaacggtcg cttggtcttc       120
     gaggtggacg cgcgcaagaa ccccgtgaat gtcgctgttg acgcgagcat cgggcagtac       180
     aacgcggatt ctatcgctga gttgttccat ggggcggcgc gggacgcgtg ccaggacgtg       240
     gaccggcaga tgcgggaagc ccttgtggag ttcggggagg accagaagac cagggagctt       300
     gtgcgcgagc tgatggggcc gctgagtcct cgcctgccgc ctgctccggg ggcgcagcaa       360
     cgccaagcgg agccgcaagg cccggacccg gacgacgagg aagcgtggaa cgacgcgcga       420
     agctggctgg agaaagcgta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page