(data stored in ACNUC7421 zone)

EMBL: CP001958.PE309

CP001958.PE309       Location/Qualifiers
FT   CDS_pept        complement(287080..289980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0315"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: mab:MAB_2210c MmpL
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96802"
FT                   /db_xref="GOA:D6ZB43"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB43"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ADG96802.1"
FT                   /translation="MNRADSRSGARAFAARVRGEFSVSSLREGCARKEGRPLVARLLYG
FT                   FSVPIVAVWLLLAAGLNLAVPQLEKVVELHALSFLPDEASSVQAIANMGKYFGQGGTNN
FT                   FVAVLLEGEEPLGADAHRYQAELMGKLNADKKHVITAIDLWSNPTFAPAFESSDKKASF
FT                   AYLNLTGNMGTALAMESTQAVRDIIAKTPPPKGVKAYVTGPAAVVNDELLSINRSIIPV
FT                   VAACTLLITLTMLLVYRSLLTAGMPLLVVGVALLTARPLVALLGAHEIIGVSIFASSLL
FT                   AGIILGAGTDYGIFLLGRYQEARQAGEDPATAYYTALSGVQHVVFASGLTVAGATACMS
FT                   FTRLSIFSTSGLPCTIGILTALAAALTLGPALLAVGSRLGFYEPRGQRAARRWRRVATR
FT                   VVRWPGPVLVGSAAVLAAAILVLPTYVTSYNERAAQPDTTEANVGLAAADRHLPPNLLN
FT                   PNLLFVESDHDMRNPADLIALAKLTNAVYAVNGVRAVQGITRPLIAPLPQGTLTYQAGY
FT                   VGERMSQMTAMLTAQLGGIASLSDRIGSLSFAVKGLQAELGAARQGLGQSIHSGQGLQA
FT                   EFLDVLEKARSVRDDVRPLSDAGEQLANSIPNCENIPYCHAALTGLSLLDNLDQFDERG
FT                   VQDLLNGARTASQSLPRLDAQIRVLGDFLNEMQQTLAPVRHMLDSLTPQISEITEFTRQ
FT                   VAESFGGADPSGFFFLPSQAFQSPLFQSALSVFFSPDGKVTRMLVMGDVNSFSKASMDY
FT                   SARIVPAATAALKGTSLGGSKVSLGGAGGTLLNIAAFAKEDFITSAVAAFAFVFCVVLV
FT                   LLRSFVAAVAVVGTVAISYLSAWGLSVAIWQHLAGLPLHWAVAPCSFVFLVAVGADYNL
FT                   LLVTRFQEELRAGIKTGIVRSMAGTGSVVTTAGLVFGFTMLAMLAGYSTILAQIGTMVG
FT                   GGLLLDTLVVRSLVIPAIATLLGRWFWWPIPVRNRP"
     gtgaacaggg cggacagcag gagcggcgcc cgcgctttcg ccgcacgcgt gcggggcgaa        60
     ttctctgtgt cgtccctgcg ggaaggatgc gcccgaaaag aaggcagacc gctggtcgcg       120
     aggctcttgt acgggttctc cgtgcccatc gtcgcagtgt ggttgctgct tgccgccggg       180
     ctgaacctcg ctgtgcccca gctcgaaaag gtcgtggagc tgcacgcctt gtccttcttg       240
     ccggatgagg cctcgtcggt gcaagcgatc gccaacatgg gcaagtactt cggccaaggc       300
     gggaccaata atttcgtggc ggtgctgctc gaaggcgaag aaccgctggg cgcggacgcg       360
     caccgctacc aagccgagct gatgggaaag ctgaacgcgg acaagaaaca cgtcatcacc       420
     gcgatcgact tgtggtccaa ccccacattc gcgcccgcgt ttgagagctc cgacaaaaag       480
     gcgtcgttcg cctacctcaa cttgaccggc aacatgggca cggccctggc gatggagtcc       540
     acccaggctg ttcgcgacat catcgcgaag accccgccgc cgaaaggggt caaagcctat       600
     gtgaccggac cggcggcagt cgtcaacgac gagctcctgt cgatcaaccg gtcgatcatc       660
     ccagtggtgg ccgcttgcac gctgctcatc accctgacca tgctccttgt gtaccgctcg       720
     ctgctgacgg cgggcatgcc gctgctcgtg gtgggagtcg ccttgctgac agcgaggccg       780
     ctcgtcgcgc tcctcggcgc acacgagatc atcggggtct ccatcttcgc ctcgagcctg       840
     ctcgccggga tcatcctcgg cgcggggacg gactacggca tcttcctgct gggcaggtac       900
     caggaggcca gacaagcggg ggaagaccct gccacggcgt attacacggc cctgtcgggc       960
     gtgcagcacg tcgtcttcgc gtccggtctg accgtcgcgg gggccaccgc gtgcatgtct      1020
     ttcacccggc tctccatttt ctccacctcg ggcctgccct gcaccatcgg catcctcacc      1080
     gcgctcgcgg cggcgctgac cctcgggcca gcgctcttgg cggtcggcag cagactcggc      1140
     ttctacgagc cgcgcgggca acgcgccgcg cggcgttggc ggcgcgtcgc cactcgcgtg      1200
     gtccgctggc ccggcccggt gctggtgggc agcgccgccg tgctcgcagc ggcgatcctc      1260
     gtcttgccga cctacgtcac cagctacaac gaacgcgcgg cgcagccgga cacgacggag      1320
     gcgaacgtcg gcctggccgc cgcggaccgg cacctgccgc ccaatctttt gaacccgaac      1380
     ctgctcttcg tcgagtccga ccacgacatg cgcaatcccg cagacctgat cgcgctggca      1440
     aaactgacga acgcggtcta cgccgtgaac ggcgtgcggg cggtgcaggg catcaccagg      1500
     ccgctgattg ctccgctgcc gcaggggacg ctgacctacc aggcgggtta tgtcggcgag      1560
     cggatgtcgc agatgacggc aatgctcacc gcgcagctcg gcgggatcgc ctcgctttcc      1620
     gaccgcatcg ggagcctctc tttcgcggtc aagggcttgc aagcagaact gggcgcggcg      1680
     cggcagggcc tcggacagtc catccacagc ggccagggcc tccaggcgga gttcctcgac      1740
     gtgttggaga aagcgcgttc cgtgcgcgac gacgtgcgac cgctgagcga cgcgggcgag      1800
     cagctcgcga actcgatccc caactgcgag aacatcccgt actgccacgc ggcgctcacc      1860
     gggctctcgc tcttggacaa tctcgaccaa ttcgacgagc gcggcgtgca ggaccttctc      1920
     aacggggcgc gcaccgcctc gcagtccctc ccgcgattgg acgcgcaaat ccgggtgctg      1980
     ggcgatttcc tcaacgagat gcagcaaacg ctcgcgccgg tgcgccacat gctcgactcg      2040
     ctgacgcccc agatctccga gatcaccgag ttcacgaggc aagtcgcgga aagcttcggc      2100
     ggcgcagacc cgagcggttt tttcttcctg ccgagccaag ccttccaatc cccgctgttc      2160
     caatcggcgc tctctgtgtt cttctcgccg gacggcaaag tcacccggat gctcgtcatg      2220
     ggcgatgtga actccttcag caaagcaagc atggactaca gcgcccggat cgtccccgcg      2280
     gccaccgctg cgctcaaagg cacctcgctc ggcggcagca aagtcagcct cggaggggcc      2340
     ggaggcaccc tgctcaacat cgcggccttc gccaaagaag acttcatcac cagcgcggtc      2400
     gcggccttcg cgttcgtgtt ctgcgtcgtg ctggtcctgc tgcgcagttt cgtcgccgcc      2460
     gtcgcagtcg tcggcaccgt ggcgatctcc tacctctccg catgggggct cagcgtcgcg      2520
     atctggcagc atctcgccgg cctgcccctg cactgggctg tcgcgccctg ttctttcgtc      2580
     ttcctcgtcg cggtcggcgc ggactacaac ctgttgctcg tcacccgttt ccaagaggag      2640
     ctgcgcgccg ggatcaaaac cggaatcgtc cgttccatgg cgggcaccgg cagcgtggtc      2700
     accacggcgg gactggtctt cggcttcacg atgctcgcga tgctcgcggg atactccacc      2760
     atcctcgccc aaatcggcac catggtcggc ggcggcctcc tcctggacac cctcgtggtc      2820
     cgctcgctcg tcatcccggc catcgcgacg cttctcggcc ggtggttctg gtggcccatc      2880
     ccggttcgca accgcccctg a                                                2901
//

If you have problems or comments...

PBIL Back to PBIL home page