(data stored in ACNUC7421 zone)

EMBL: CP001958.PE31

CP001958.PE31        Location/Qualifiers
FT   CDS_pept        28917..29114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96524"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96524.1"
FT                   /translation="MTGQKKDERCAWCERAFRAHVAAGGSWASAPRVRAAQTRTHPGKG
FT                   GEPVCMEHRAEFTGVFGVLI"
     atgaccggcc agaagaagga cgagcggtgc gcttggtgcg agcgggcgtt ccgcgcgcat        60
     gtggccgctg ggggttcgtg ggcgagcgcg ccgagggtgc gggcggcgca gacgcgcacg       120
     catcccggca agggcggcga gccggtgtgc atggagcacc gggccgagtt cacaggcgtg       180
     ttcggagtgc tcatatga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page