(data stored in ACNUC7421 zone)

EMBL: CP001958.PE310

CP001958.PE310       Location/Qualifiers
FT   CDS_pept        complement(289977..290390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0316"
FT                   /product="membrane family protein"
FT                   /note="PFAM: membrane family protein; KEGG: mab:MAB_2211c
FT                   putative membrane protein, MmpS"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96803"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB44"
FT                   /inference="protein motif:PFAM:PF05423"
FT                   /protein_id="ADG96803.1"
FT                   /translation="MKSAWPYLVSLLILVAAGGFIAHLRSSSIPDEAVGFASALPKLGQ
FT                   SPQRTIDYEASGPAGTPVRVSYLDEHAQAHDADAVLPWQESLRTASPTVMTGLIVQSKA
FT                   GGVGCRIIIDGTVRDEQPPSASANVANCKVQVA"
     atgaaaagcg cctggccgta tctcgtctcg ttgctgatcc tcgttgcagc gggcggattc        60
     atcgcgcacc tgcgctcaag ctcgatcccg gacgaggcgg tcggtttcgc gagcgccctg       120
     ccgaaactcg ggcaatcccc gcaacggacg atcgactacg aggccagcgg accagctgga       180
     accccggtgc gggtgtccta cctcgacgaa cacgcccaag cccatgacgc cgacgcggtg       240
     ctgccctggc aggagtcgct gcgcaccgcc agtccgacag tgatgaccgg gctgatcgtg       300
     cagtcgaaag caggaggcgt cggatgcaga atcatcattg acggaacagt ccgcgacgaa       360
     caaccgccca gcgcgtcggc gaacgtggcg aactgcaagg tccaggtcgc gtga             414
//

If you have problems or comments...

PBIL Back to PBIL home page