(data stored in ACNUC7421 zone)

EMBL: CP001958.PE313

CP001958.PE313       Location/Qualifiers
FT   CDS_pept        298279..299055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0319"
FT                   /product="Thioesterase"
FT                   /note="PFAM: Thioesterase; KEGG: mab:MAB_2213 putative
FT                   thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96806"
FT                   /db_xref="GOA:D6ZB47"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB47"
FT                   /inference="protein motif:PFAM:PF00975"
FT                   /protein_id="ADG96806.1"
FT                   /translation="MSAKIRSPQEFWWWPRPYNPALPTVLHFACSGSDHTGEIRLAPHM
FT                   EGVNFGVWRMPGRGARADEPPSTSLQRLVDEITTAALGLDCRSPVLSGHSFGGLLGYLV
FT                   CQELESQGRAVGRFVPVASADPSVWRRDAALAKLFGGPKKHAQRRVVMFEERGVWPPEG
FT                   AESATVLQAARSRLEGDIALGLQSFRHDRINASITEVSAKDDEILKERAAQRRWAQHTS
FT                   GEFESIAVTGGHFFYWRRPQVLATILKSEVELAQHN"
     gtgagcgcga aaatccgctc tcctcaagag ttctggtggt ggccgaggcc ctacaatcct        60
     gcgctgccca cggtgctgca cttcgcttgc tcgggatcgg accacaccgg cgagatccgc       120
     ctcgccccgc acatggaagg ggtgaacttc ggggtgtggc ggatgcccgg gcgcggagcc       180
     agagccgacg aaccgccctc caccagcctg cagcgcctcg tggacgagat cacgacggcg       240
     gctctggggc tcgactgccg gtcgccggtg ctcagcgggc acagtttcgg cgggctgctc       300
     gggtacctcg tctgccaaga gctggagtcc cagggacgcg cagtgggcag attcgtgcct       360
     gtggcgagcg ctgacccgtc agtgtggcgc agagacgccg ccctcgcgaa gcttttcggc       420
     gggccgaaga aacacgcgca acggcgcgtg gtgatgttcg aagagcgagg cgtgtggccc       480
     cccgagggag ccgaatcggc gacggtgttg caggcggcgc ggtcccggtt ggagggcgac       540
     atagcgttgg gcctgcaatc gttccggcat gatcggatca acgcttcgat cacggaagtg       600
     agcgcgaaag acgacgaaat cctcaaggaa cgggcggcgc agcgccggtg ggctcagcac       660
     acgtcggggg aattcgagag catcgccgtg accggcgggc atttctttta ttggcggcgg       720
     ccccaagtct tggcgaccat cttgaagagc gaagtcgagc tggcccagca caactga          777
//

If you have problems or comments...

PBIL Back to PBIL home page