(data stored in ACNUC7421 zone)

EMBL: CP001958.PE316

CP001958.PE316       Location/Qualifiers
FT   CDS_pept        302330..303520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96809"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB50"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96809.1"
FT                   /translation="MLPCEDVDALLKDVGEFIAYFSMVARGPGGPAVDWTGKVGFTSGD
FT                   VRIDLVADDAVHEVWTEDGKEEKARSFSAFPLAGKCVWFDLLCGLLDEEDGYETYQQWI
FT                   HRPPSADVGICNNKKGPDNKRVQQLYVKSSPYITYPIDPDDQDTNAEIAHTMAASYKEI
FT                   WETVARKFSQEQLQAFGPLPKVVEHRHLGDGKAKQGKEDSEKLRHPDTAALLRDLGEFL
FT                   GSMGAVLVAAQQRGGGSGFVRAGVGPVGAVVFNSPNIPELLRVHEKSLLLLRKVQGELL
FT                   PGPAFSGFDVAGKYCLLHYGDRLRASLSAPSVLEDWYAKGQHAQVVVEEAGAHAVRVSD
FT                   MNDPERHAVVHPLETTLMSQLLHTDYKELLTSLLDGLPAPQDAKRAAPISTPWGDF"
     atgctcccct gcgaagacgt ggacgccctg ctgaaggatg tgggcgaatt catcgcctac        60
     ttcagcatgg tggcgcgagg ccctgggggc cctgcggtcg actggaccgg aaaagtcggt       120
     ttcaccagcg gcgacgtcag aatcgacctc gtcgccgacg acgccgtcca cgaggtctgg       180
     acggaggacg ggaaagagga gaaggcccgg agtttttccg ccttcccgct cgccgggaaa       240
     tgcgtttggt tcgatttgct ctgcgggctc ctcgacgagg aagacggcta cgagacctac       300
     cagcagtgga tccaccgtcc cccttccgcc gacgtcggca tatgcaacaa caagaagggt       360
     cccgacaaca aaagggtcca gcagctctac gtcaaaagct ccccgtacat cacgtacccg       420
     atcgaccctg acgatcagga cacgaacgcc gaaatcgcgc acaccatggc cgcgagctac       480
     aaggagatct gggagacggt cgcccggaag ttctcccagg agcaattgca agccttcggc       540
     ccgctgccga aagtggtcga gcaccgccac cttggggacg ggaaagccaa acaaggcaaa       600
     gaggactccg agaagctccg ccatcccgac acggccgccc tgctgcgcga cctcggcgaa       660
     ttcctcggct ccatgggcgc ggtcctcgtt gcggcgcagc agcgcggcgg cggctccggt       720
     ttcgtgcgcg ccggcgtcgg tccggtcggc gcggtggtct tcaacagccc gaacatcccc       780
     gaactgctcc gggtccacga gaaaagcctg ttgttgttgc gcaaggtcca gggcgagctg       840
     ctgcccggcc ccgccttctc cgggttcgac gtggcgggca aatactgcct cctgcactat       900
     ggcgaccggc tgcgggccag cctgtcggct ccgagcgtgc tcgaggactg gtacgcgaag       960
     gggcagcacg cccaggtcgt cgtcgaagag gccggggcgc atgctgtgcg agtttcggac      1020
     atgaacgatc ccgagcgtca cgctgttgtc catccgttgg agacgacgct catgagccag      1080
     ctcctgcaca ccgactacaa ggagctgctc accagcctgc tcgacggatt gcccgcgccc      1140
     caggacgcga agagagcggc accgatcagc accccgtggg gcgatttcta a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page