(data stored in ACNUC7421 zone)

EMBL: CP001958.PE32

CP001958.PE32        Location/Qualifiers
FT   CDS_pept        29111..29863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2785 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96525"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96525.1"
FT                   /translation="MSGLVRIEKGRNHFYELDGERVDGVTTILSGGIPKAALMPWALKT
FT                   AAQFAVENWDELCGLGQFERVDQIKKAPWRERDEAANRGSEVHRLAERLMRGEEVTVPA
FT                   TLSGHVRSCVDFLDEWQPVPVLLECPVASRAERYAGTLDAVVDIPGEGRCLIDFKTSRS
FT                   GVHPETGLQLAAYRHADFALAGGEEVAMGGLGVERAFGVWLRPDGYSVHELRAGAEEFA
FT                   VFLSAARIARWAKTSKQVVGEALERQKH"
     atgagcgggc ttgtgcggat cgagaagggc cgcaaccact tttacgagct ggacggcgag        60
     cgtgtggacg gtgtgacgac gatcctcagc ggcgggatac ccaaggctgc gttgatgccg       120
     tgggcgttga agacggcggc gcagtttgcg gtggagaact gggacgagct gtgcgggctc       180
     gggcagttcg agcgcgtgga ccagatcaag aaggcccctt ggcgcgagcg ggacgaggcg       240
     gcgaaccggg gctctgaggt gcataggctc gcggagcggc tgatgcgcgg cgaggaggtg       300
     accgttccgg ccacgttgtc ggggcatgtg cgctcgtgcg tggacttcct ggacgagtgg       360
     cagccggtgc cggtgttgct ggaatgcccg gttgcgtccc gagcggagcg gtacgcgggc       420
     acgttggacg cagtggtgga cattcccggc gaggggcgtt gcctgatcga cttcaaaacc       480
     tcccgttcgg gcgtccaccc ggagacgggg ttgcagctcg cggcctatag gcacgcggac       540
     ttcgccctgg cgggcgggga agaggtcgct atgggcggtc ttggcgtcga gagggcgttc       600
     ggggtgtggc tgcgcccgga cggctacagc gtccacgagc tgagggcggg agccgaggag       660
     ttcgcggtgt tcctcagcgc cgcgcgcatc gcccgctggg cgaagacatc gaaacaagtt       720
     gtcggtgaag ctttggaaag gcagaagcat tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page