(data stored in ACNUC7421 zone)

EMBL: CP001958.PE320

CP001958.PE320       Location/Qualifiers
FT   CDS_pept        306253..306525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0326"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   nfa:nfa760 putative septation inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96813"
FT                   /db_xref="GOA:D6ZB54"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB54"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ADG96813.1"
FT                   /translation="MPKSKVRKKTDFTINPGAAGAGSARTAPSSTWYVALMLGFMLAGL
FT                   AWLVVYYIAAADLDALKWMADLQFWNLAIGFGLMVVGLLMTMRWH"
     atgccgaagt cgaaggtccg caagaagacc gacttcacga tcaaccccgg cgccgctggc        60
     gcgggctcgg cccgcacggc tccgtccagc acctggtacg tggccctgat gctcggcttc       120
     atgctcgccg ggctggcgtg gttggtggtg tactacatcg ccgccgcaga cctcgatgcg       180
     ctcaagtgga tggccgacct gcagttctgg aatttggcca tcggtttcgg cctgatggtc       240
     gtcggcctgc tcatgacgat gaggtggcat tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page