(data stored in ACNUC7421 zone)

EMBL: CP001958.PE323

CP001958.PE323       Location/Qualifiers
FT   CDS_pept        complement(308783..309640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96816"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB57"
FT                   /inference="similar to AA sequence:KEGG:MAB_0843"
FT                   /protein_id="ADG96816.1"
FT                   /translation="MNLTAHAVRALTALSLALGVCGCGNSQPQQPDRGGVELVGLFRFD
FT                   PAAYLGPDKAPTGTWFQMLTPAGGVMSNANPGSPVWQVNGKPVPGAYTSLAPGVGGGLR
FT                   AGGYQSLPDPAFAGTPTDPKAGDSLADSVTQPTPFFLVKFSISTNATDPQTQRPVGPPK
FT                   VLLRTDGTLAADLSSWAATWNGQYFNQGAPKPRPAKDAQVQGAAQVKQVWDWAAQKFLD
FT                   APVADNIPQGDWATGSYDPATRHYSLQWRSLIVGGPFDKFTGLWHLEGVFEPSTGPVPH
FT                   GPSS"
     atgaatctca cagcacacgc ggtccgggct ctcaccgcct tgtccctcgc ccttggcgtg        60
     tgcggatgcg gcaactcgca accgcaacag cccgaccgcg gcggcgtcga gctcgtcggg       120
     ctcttccgct tcgacccagc cgcctatctc ggcccggaca aagctcccac ggggacctgg       180
     ttccagatgc tcaccccggc gggcggggtg atgtcgaacg ccaacccggg atctcccgtc       240
     tggcaggtca acgggaaacc agtgcccggc gcgtacacct ctctcgcccc tggcgtcggc       300
     ggcggcttgc gcgcaggtgg ctatcagagc ctgccggacc cggcgttcgc gggaacgccg       360
     accgacccga aggcgggcga ctcgctggcg gactcggtga cgcagccgac cccgttcttc       420
     ctcgtcaagt tctcgatctc caccaatgcg accgatccgc agacccagcg ccccgtcggc       480
     ccgccgaagg ttttgctgcg gacggacggg acccttgccg ctgacctgtc cagctgggcc       540
     gcgacctgga acggccaata cttcaaccag ggcgcgccga aaccacgacc ggcgaaagac       600
     gcgcaggtcc aaggcgcggc gcaggtcaaa caggtatggg actgggctgc gcagaagttc       660
     ctcgacgccc cagtcgccga taacatcccg cagggcgatt gggcgactgg ttcctatgac       720
     cccgcgacac gccattacag cctgcaatgg cgcagtttga tcgtcggcgg cccgttcgac       780
     aagttcaccg ggctctggca tctcgaaggg gtgttcgagc cctctacggg gcctgtgccc       840
     cacgggcctt cttcgtga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page