(data stored in ACNUC7421 zone)

EMBL: CP001958.PE324

CP001958.PE324       Location/Qualifiers
FT   CDS_pept        complement(309637..310650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0842 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96817"
FT                   /db_xref="GOA:D6ZB58"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB58"
FT                   /inference="similar to AA sequence:KEGG:MAB_0842"
FT                   /protein_id="ADG96817.1"
FT                   /translation="MVELPKHGPELSKHEETAKKPDRGRARAAWLGEYWLWGVLVLLGA
FT                   AFMLAPIRLGMYSESAEGQRMVERFTPVLTDQRLHQLENHLAVIEAARAETAERRLPHD
FT                   DLSHSNTISFVAQFPETEARFSSWIATMRADEGAFGQLRSLPPFGLFPFVFGFAGLALV
FT                   VIGMTGLFSASARTRTALRSAAALVGVLLVLFPVTAGVFAHSSAGTKLLRDFRPILTEE
FT                   NVRWAQSEFVVIGPSSAELLNDLHTHPGANLPATKAFVDQWATISADFANVIEEFADNL
FT                   GHFQALERLNETTKPLGLDAFDEFGWFYLVPGLALVLVVGADVLLSRNRNNAQEQV"
     ttggttgaac tgcccaagca tggtcctgaa ctgtcaaagc acgaggaaac cgccaagaag        60
     cccgaccgcg ggcgcgcacg cgccgcatgg ctgggcgagt actggctttg gggggtgctc       120
     gtgctcctcg gcgcggcctt catgctcgcc ccgatccggc tcggcatgta cagcgagtcg       180
     gccgaaggcc agcgcatggt cgagcggttc acccccgtgc tcaccgacca acgcctgcat       240
     cagctcgaaa accacctcgc ggtgatcgag gcggcgcggg cggagaccgc cgagcggcgt       300
     ctgccgcacg atgacctctc ccacagcaac accatcagtt tcgtcgcgca gttccccgag       360
     accgaagccc gtttctccag ctggatcgcg accatgcgcg ccgacgaggg ggcctttggg       420
     caactgcgct ccctcccgcc gttcggcctc ttcccgttcg tgttcggctt cgcaggattg       480
     gcgctggtcg tcatcggcat gactggcctg ttcagcgcct cggcgcgcac gcgcacggcg       540
     ctgcgatccg ccgcagccct ggtgggagtc ctcctcgtgc tcttcccggt caccgcaggg       600
     gtgttcgccc actcgtccgc aggcacgaaa ctgttgcgcg atttccgccc gatcctcacc       660
     gaggagaatg ttcggtgggc gcaaagcgaa ttcgtggtga tcggcccttc ttccgcggaa       720
     ctgctcaacg acctgcacac acaccccggc gcgaaccttc ccgcgacgaa ggcgttcgtg       780
     gaccagtggg cgacgatcag cgccgatttc gcgaacgtga tcgaggagtt cgccgacaac       840
     ctcggccact tccaggcgct cgaacggctc aacgagacca ccaagccgct gggcttggac       900
     gcctttgacg agttcggctg gttctacctc gtcccagggc tggcgttggt gctcgtggtc       960
     ggagccgacg tgcttctcag caggaatcgc aacaacgcgc aggagcaggt atga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page