(data stored in ACNUC7421 zone)

EMBL: CP001958.PE326

CP001958.PE326       Location/Qualifiers
FT   CDS_pept        complement(311655..313496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0332"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   pfs:PFLU1373 putative hemolysin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96819"
FT                   /db_xref="GOA:D6ZB60"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR028208"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB60"
FT                   /inference="protein motif:PFAM:PF00353"
FT                   /protein_id="ADG96819.1"
FT                   /translation="MALTWKDILADISGPGNALVQAIRRRGEGFPEIGAHIRGHESLLA
FT                   GWAGAARTSADAVFAQNHAYTGAAGSAAAQLASALGRVVDERAELLRLASNIVEDGAQL
FT                   RFTFSDTGEINDFYGASGLWSELPDDEQAQYLALREELPRRVADVIAQGNALDDEAATA
FT                   LTSAGGLAAPSALGSGEGEAQSQGDGLAFTRDQGMVVFQTGDGDDTVSVQQASGGRLVV
FT                   TVNGRSQTLSAQDSQDVLIQTQGGNDRVSVDPHVAVRVRFQLGDGADVIDDQAVGGSYI
FT                   DAGKGDDTVTLGQGHNTVYLGSGNNTVTGSKGADYINGGSGNNKINAGSGNSVLYGGTG
FT                   QNTINAGAGRNTIYTGTGEATINNQGGQDTIYAQAGAHVNAGFGTNRTVTIQPLEIPDT
FT                   ITVQGSPEFQRRMQDDLELLAASPDGQHMLRALGSSGHNLLIDDGHLLNDGKVLYNNGY
FT                   TAPAVGDQPTNSSDFFYDMERHRPGPGTDAIISIDTTLTNLGALAQGPKPDYHELNPAV
FT                   VLYHEMAHAYDDTHGSMMPGEYGPSGTDPIDSQNIGGWNPQYLANAEHEAVGLPLDWDG
FT                   DPKTPEVAVPDSVHPHDLTENALRDEMGIPDREHYLG"
     atggcgttga cgtggaagga cattctcgca gacatctccg ggccaggcaa cgccctcgtg        60
     caagccatac ggcggcgggg tgagggcttc ccggaaatcg gcgcgcacat ccgagggcac       120
     gagtccttgc tcgccggttg ggccggagcc gcccgcacga gcgcggacgc cgtgttcgcg       180
     cagaaccacg cgtacacggg ggcagcggga agcgcggcgg cgcaactggc ttcggccctc       240
     ggccgggtcg tggacgaacg cgcggagctt ctgcgcctgg cctcgaacat cgtcgaagac       300
     ggcgcgcagc tgcgtttcac gttctccgac accggcgaga tcaacgattt ctacggcgcg       360
     agcggcctgt ggagcgagct gcccgacgac gagcaggccc aatatctcgc gctccgcgag       420
     gagctgccca gacgggtcgc cgacgtgatc gcccaaggca acgcgctcga cgacgaagcg       480
     gccaccgccc tgacgagcgc gggcggcctc gccgccccct cggcgctggg ctcgggcgaa       540
     ggcgaagccc agagccaggg tgacggcctc gccttcaccc gcgaccaggg catggtggtc       600
     ttccaaaccg gcgacggcga cgacacggtc tcggtccagc aggcttccgg gggacgactg       660
     gtcgtcaccg tgaacggcag gtcccagacc ctcagcgccc aagattcgca ggacgtgctc       720
     atccagaccc aaggcggcaa cgaccgcgtc tcggtggacc cgcacgtcgc ggtccgggtc       780
     cgcttccagc tcggcgacgg cgccgacgtg atcgacgacc aagccgtggg cggctcctac       840
     atcgacgccg gcaaaggcga cgacacggtc acgctcggcc aaggccacaa caccgtctac       900
     ctcggctccg gcaacaacac ggtgaccggc agcaaaggcg ccgactacat caacggcggc       960
     tccggcaaca acaagatcaa cgcgggctcc ggcaacagcg tcctctacgg cggcaccggt      1020
     cagaacacca tcaacgccgg cgccggccgc aacaccatct acaccggcac gggcgaagcc      1080
     accatcaaca accagggcgg ccaggacact atctacgccc aggcgggcgc ccacgtcaac      1140
     gcgggcttcg ggaccaatcg caccgtcacc atccagccgc tggagatccc cgacaccatc      1200
     accgtccagg gctcgcccga gttccagcgc aggatgcagg acgacctcga actgctcgcc      1260
     gcctcccccg acggacagca catgctccgc gcgctcggca gcagcgggca caacctgctc      1320
     atcgacgacg gccacctgct caacgacggc aaggtgctgt acaacaacgg ctacaccgcc      1380
     cccgctgtcg gcgaccagcc gacgaacagc tctgatttct tctacgacat ggaacgtcac      1440
     cgccctgggc cgggcaccga cgccatcatc agcatcgaca ccacgctcac gaacctcgga      1500
     gccctcgcac aagggccgaa accggactac cacgagctca acccggcggt ggtgctgtac      1560
     cacgagatgg cgcacgcgta cgacgacacg cacggctcca tgatgcccgg cgagtacggc      1620
     ccgagcggca cggacccgat cgactcgcag aacatcggcg gctggaaccc gcagtatctg      1680
     gcaaacgcgg agcacgaggc cgtcggcctg ccgctggact gggacggcga cccgaaaacc      1740
     cccgaggtcg cagtcccgga ttcggtgcat ccgcatgacc tcaccgagaa cgcgctgcgc      1800
     gacgagatgg gcatccccga ccgcgagcac tacctcggct ga                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page