(data stored in ACNUC7421 zone)

EMBL: CP001958.PE333

CP001958.PE333       Location/Qualifiers
FT   CDS_pept        complement(319323..319967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: proteophosphoglycan ppg4"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96826"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96826.1"
FT                   /translation="MSEQKDATRKRPFVEESPSWRFPKITAQTPKEEPKRRVPATLFGG
FT                   RLRTSTFALLLLYVILDVSKKPIPTAQSPAQPWAPPTNAVFGSDGNWTVPAQVPTSQQY
FT                   QYRPTQPTSTRRPETTETSTPTTSPTPSGSESTSGSPNSSDSPDGPEPRHSRPRGQDDS
FT                   STSTAPSATGSATTPADSRPSGSAEPRPNQTRSRTASGEEGHSSGSSSARP"
     atgagcgagc agaaagacgc cacacgcaaa cggcccttcg tggaggagtc accaagttgg        60
     cgattcccga aaatcaccgc ccaaacaccg aaggaagagc cgaaacggcg ggtgcccgcg       120
     acccttttcg gcggcaggct gcgcacctcg accttcgcgc tgctcctgtt gtacgtgatt       180
     ctcgacgtgt cgaaaaaacc gattccgacc gcgcagagcc ccgcgcaacc gtgggccccg       240
     ccgacgaacg ccgtgttcgg ctcggacggc aactggacgg ttccggcgca ggtgccgacc       300
     agccagcaat accaataccg cccgacgcag cccacgagca cccggcgccc ggaaacaacc       360
     gagacctcca cccccacgac gtcgcccacg ccgtccggct cggaaagcac ctccggttcg       420
     ccgaactcct cggacagccc ggacggtcct gagccccgtc attcgcgccc gcgcggccaa       480
     gacgattcca gcacgtccac ggcgccctcg gccacagggt ccgccaccac ccccgccgac       540
     tcgcgcccga gcggctccgc cgagccgagg ccgaaccaaa cccgctcccg cacagcctcg       600
     ggcgaggagg gccacagctc gggatcaagc tccgcccggc cgtga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page