(data stored in ACNUC7421 zone)

EMBL: CP001958.PE334

CP001958.PE334       Location/Qualifiers
FT   CDS_pept        complement(319964..320944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0340"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   mbt:JTY_3124 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96827"
FT                   /db_xref="GOA:D6ZB68"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB68"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADG96827.1"
FT                   /translation="MHANLSAPAYSEWTKWLAKFGVQNFGDWMLTRGVRIVMAMIAAVL
FT                   LARFLRWAAGIFGRGGLFSQKHSGVRSEGSRQRETLAATIAWALTVLVYFVAGLRIAKL
FT                   LEFDLTGLTVPATAAGAGLGFGAQRIVQDLLSGFFIIAEKQYRIGDLVQLSVLGTTYDP
FT                   VGTVEEVTLRVTKLRSSEGQLFTVPNGQIVKSTNMSKDWSQAVVDIPVPNSTDIGLVRE
FT                   KLVEICAAAKEDPNLATLLRGEPVYTGVESIELDRTSMRIVANSVPGQQFVLSRRLRAR
FT                   ILSDLRKEGIATMASPGPAQPEDASKKTVRPPRPEEDTAPQERVR"
     gtgcacgcca acctcagcgc ccccgcgtac agcgaatgga cgaagtggct tgccaaattc        60
     ggcgtgcaga acttcggcga ctggatgctc acccgcggcg tccggatcgt catggccatg       120
     atcgccgcgg tcctgctcgc gcgcttcttg cggtgggcgg cggggatttt cggccgaggc       180
     ggcctgttct cgcagaagca ctccggcgtg cgcagcgagg gatcgcgcca acgcgagacc       240
     ctcgccgcga cgatcgcctg ggcgctcacc gtcctggtgt acttcgtcgc ggggctgcgg       300
     atcgccaaac tgctcgaatt cgacctcacc gggctcaccg tccccgcgac cgcggcgggc       360
     gcggggctcg gcttcggcgc gcagcgcatc gtgcaagacc tgctctccgg gttcttcatc       420
     atcgccgaga agcagtaccg catcggcgac ttggtgcagc tgtccgtcct gggcacgacc       480
     tacgaccccg tcggcaccgt ggaggaggtg accctgcgcg tgaccaagct ccgatcctcc       540
     gagggacagc tgttcaccgt ccccaacggc caaatcgtga aatcgaccaa tatgtcgaag       600
     gactggtcgc aggcggtggt ggacatcccc gtgccgaact cgacggacat cgggctcgtg       660
     cgcgagaagc tggtcgagat ctgcgcggcg gccaaagaag acccgaacct ggccacgctg       720
     ttgcgcggcg agcccgtgta cacgggggtg gagagcatcg aactcgaccg gaccagcatg       780
     cgcatcgtcg cgaactccgt gcccggccaa cagttcgtcc tcagccggag gctgcgggca       840
     cgaatcctca gcgacctgcg caaagaaggc atcgcgacca tggcgagccc aggcccggcg       900
     cagcctgagg acgcgtcgaa gaaaaccgtc cgcccgcccc ggcccgaaga agacaccgcg       960
     ccgcaggagc gtgtgcgatg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page