(data stored in ACNUC7421 zone)

EMBL: CP001958.PE337

CP001958.PE337       Location/Qualifiers
FT   CDS_pept        322427..322885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0343"
FT                   /product="ribosomal protein L13"
FT                   /note="KEGG: nfa:nfa8660 50S ribosomal protein L13;
FT                   TIGRFAM: ribosomal protein L13; PFAM: ribosomal protein
FT                   L13"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96830"
FT                   /db_xref="GOA:D6ZB71"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB71"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADG96830.1"
FT                   /translation="MPTITHTTYSPKAADLNHQWHVIDATDVVLGRLAVTAATLLRGKH
FT                   KPTYAPHLDNGDFVVIVNAGKVALTGNKRADKLVHRHSGHPGGLKTRSIGQLLDSDPRR
FT                   VVEKAVKGMIPRNKLGRAVERKLKVYAGPEHPHQAQQPVPYAITQVSQ"
     ttgcccacga ttacacacac cacatacagc ccgaaggctg ccgacctgaa ccatcagtgg        60
     catgtcatcg acgcgaccga cgtcgtgctc ggccggttgg cggtgactgc ggcgaccctg       120
     ctgcgcggca agcacaagcc gacgtacgcc ccgcacctcg acaacggcga cttcgtcgtc       180
     atcgtgaatg ccgggaaagt cgccctgacc ggcaacaagc gcgctgacaa gctggtgcac       240
     cgccactccg gccaccccgg cggcctcaag acccgcagca tcgggcagct gctcgacagc       300
     gatcctcgcc gcgtggtgga gaaggccgtc aagggcatga tcccgcgcaa caagctgggc       360
     cgcgccgtgg agcgcaaact caaggtgtac gcaggcccgg agcacccgca ccaggcccag       420
     cagcccgtgc cgtacgccat cacccaggtt tcgcagtga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page