(data stored in ACNUC7421 zone)

EMBL: CP001958.PE339

CP001958.PE339       Location/Qualifiers
FT   CDS_pept        323459..324820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0345"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; KEGG:
FT                   gbr:Gbro_1687 phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96832"
FT                   /db_xref="GOA:D6ZB73"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB73"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADG96832.1"
FT                   /translation="MTALFGTDGVRGVANTELTPELALTLGSLAGSRLRGESGLAVVGR
FT                   DPRISGAMLEACVCAGLASSGVRVLRAGVLPTPAVSWLVKDLGADLGVVVSASHNPMPD
FT                   NGLKFFGPGGGKLDAETENLLAADVSRVSKGGKASWGWGEGERPTGAGVGDLVDFPEGA
FT                   ARYVSRFAPITPKAGQLRVVVDCANGATSRLAAQVYEATGAEVITLNAEPDGLNINDRC
FT                   GSTHLDGLRAAVLEEGADLGLAHDGDGDRCLAVAEDGDVVDGDAIMAVLALGLHERGQL
FT                   RHNKLVVTVMSNLGLHIAMRAAGVELEVTQVGDRHVTDALREGGYSIGGEQSGHVVIPE
FT                   LGETGDGMVTGLRLISRIVESGKSLSELASVVQVYPQVLVNVPVVDKLAAASDLSVLDA
FT                   VASAQERLGGKGRVLLRPSGTEQLVRVMVEAESALSAHEVAEQVAGLVRATNLK"
     atgacagcac tgttcggcac cgacggtgtt cgtggtgtcg cgaacaccga gctgacgccc        60
     gagttggcgt tgacactcgg atctttagct ggctcgaggt tgcgcggcga atccggtctc       120
     gccgtggtcg gccgcgaccc ccgcatctcc ggcgcgatgc tcgaagcatg cgtgtgcgct       180
     gggctggcaa gctccggcgt gcgcgtgctc cgggcgggcg tgctgccaac tcccgcggtg       240
     tcctggctgg tcaaagatct cggagccgat ctcggcgtgg tggtctccgc gtcgcacaac       300
     cccatgccgg acaacgggct caagttcttc gggcctggcg gcggcaagct cgacgcggag       360
     accgaaaacc tgctcgccgc cgatgtctcg cgcgtcagca agggcggcaa ggcgagctgg       420
     ggatggggcg aaggggagcg gcccaccggc gcgggcgtcg gagacctcgt cgatttcccc       480
     gaaggcgcgg cgcgctatgt gtcccgtttc gcgccgatca ccccgaaagc cgggcagttg       540
     cgtgtggtcg tggactgcgc caatggcgcg acttcgcgtt tggcggccca ggtgtacgag       600
     gccacgggcg ccgaggtcat cacgctcaac gccgaaccgg acgggctcaa catcaacgac       660
     cgctgcggtt ccacgcacct cgacggcctg cgcgcggcgg tgttggaaga aggcgcggac       720
     ctaggcctcg cccatgacgg ggacggggac cgctgcctcg ccgtcgccga ggacggcgac       780
     gtggtggacg gggacgccat catggctgtt ctggcgctcg gcctgcatga gcgcggccag       840
     ctgcgccata acaagctcgt ggtgaccgtg atgagcaacc tcggtttgca catcgcgatg       900
     cgcgcggcgg gcgtcgagct tgaggtcacc caggtcggcg accggcatgt gaccgacgcg       960
     ctccgcgagg gcggctactc catcggcggc gagcagtccg gccacgtcgt cattcctgag      1020
     ctgggggaaa ccggcgacgg catggtcacc ggccttcgtc tgatctcccg cattgtggag      1080
     agcggcaaga gcctttccga gctcgcttct gtcgtgcagg tgtatccgca agtcctggtc      1140
     aatgtgccgg tggtcgacaa actcgccgcc gccagcgatc tgtccgtgct cgacgcggtc      1200
     gcgtccgcgc aggaacgcct cggcggcaaa gggcgtgtgc tgctgcggcc gtccggcacc      1260
     gagcagctgg tccgtgtcat ggtcgaggcc gaatcggcgc tgagcgcgca cgaggtggcc      1320
     gaacaagtgg ctggactggt ccgcgccacc aatctgaagt ag                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page