(data stored in ACNUC7421 zone)

EMBL: CP001958.PE349

CP001958.PE349       Location/Qualifiers
FT   CDS_pept        333940..334647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0355"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG: nfa:nfa8820
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96842"
FT                   /db_xref="GOA:D6ZB83"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB83"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ADG96842.1"
FT                   /translation="MLALTLDTSTSDSSVGLVFWPPGGTGWRTLGEERVPGNVHVEQLA
FT                   PMLERRLREARERHGQAGAVQAVVVGLGPGPYTGLRIGIATAAAYGDAAGLPVHGVCGL
FT                   DAVAHDVSRAAPDEQDLLVVADAKRREVFWARYLGARRIGPLGVCPPAELPELLDGCVP
FT                   QLAAGATRLLDGTALQDVPRSPVAAPSPCGLAAAIAQELLSGAAPGPLAPLYLRAPDAK
FT                   PPAAPAVARNLTA"
     atgcttgcgc tgactctcga cacatcgacc tcggactcgt ccgtcgggct cgtgttctgg        60
     ccgcctggcg gaaccgggtg gcgcacgctg ggcgaggagc gggttccggg caatgtccac       120
     gtcgaacaac tggcgccgat gctcgaacgt cggcttcgcg aggcacgcga gcggcacggg       180
     caggcaggcg cggtgcaggc cgttgtcgtc gggctcggcc ccggcccgta caccggcctg       240
     cggatcggga tcgcgaccgc cgccgcgtac ggcgacgcgg cggggctgcc ggtgcacggg       300
     gtgtgcggcc tcgacgccgt cgcgcacgac gtctcgcgcg ctgcccccga cgagcaagac       360
     ctgctcgtcg tcgcggacgc gaaacgccgc gaggtgtttt gggcccgcta cctcggcgcg       420
     cgtcggatcg gcccgctggg ggtgtgcccg ccagccgaac tgcccgaact gctcgacggc       480
     tgcgtcccgc agctcgccgc cggggcgacg cgcctgttgg acggcacagc gttgcaggac       540
     gtgccgaggt ccccggtcgc ggcgccgtcc ccatgcggcc ttgccgccgc catcgcccag       600
     gaactgcttt cgggggccgc gccgggcccc ctggcgccgc tgtacttgcg agcgcccgac       660
     gccaagcccc cggccgcccc tgctgtggca aggaatctga ccgcatga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page