(data stored in ACNUC7421 zone)

EMBL: CP001958.PE354

CP001958.PE354       Location/Qualifiers
FT   CDS_pept        complement(337849..338634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0360"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rop:ROP_11270 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96847"
FT                   /db_xref="GOA:D6ZB88"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB88"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG96847.1"
FT                   /translation="MPLPPPAPGQPAVITGASDGIGKAIAFELAALGRPVLLVARRGEL
FT                   LEKTAEQIRARHGVDAQIRAVDLVDRDARRKFLDELAEMDVSVLVSNAGVVTAGLWHGR
FT                   LDPALERAEVELNVVAAYEVVLAALPKMLERGSGGVVVTGSIAGNGPAPITTTYSATKA
FT                   FLNTFAESLHFDVRGRGVNVTLLAPGVVHTGLLTGPLTRVPGFLCATAEQTAKAAVEGV
FT                   ARNKLRVAPIAAHKVQSALANYLPRPLWARAMYRFYGGK"
     atgccactgc cgccgcctgc cccagggcaa cccgctgtca tcactggagc ctcggacggc        60
     atcggcaaag ccatcgcttt cgaactcgcc gcgctcgggc gcccggtgct gctggtggcc       120
     cgccgcggcg agctgctcga aaagacggcc gagcagatcc gcgcccggca cggcgtggac       180
     gcgcagatcc gcgcagtgga cctggtggac agagacgcgc gccggaagtt cctcgacgag       240
     ctggccgaga tggacgtgtc ggtcctggtc agcaatgcgg gcgtggtgac ggcgggcctg       300
     tggcacggca gactcgaccc ggcgctcgag cgcgccgaag tggagctcaa cgtcgtggcc       360
     gcctacgagg tcgtcctggc cgcgctgccg aagatgctcg aacgcggctc cggcggcgtc       420
     gtcgtcaccg gttcgatcgc gggcaacggc cccgcgccga tcaccacgac gtactcggcg       480
     acgaaggcgt tcctgaacac cttcgccgaa agcctgcact tcgacgtgcg cggacgtggc       540
     gtcaatgtga ccctgctcgc ccctggcgtc gtccacaccg gactgctcac cggcccgctg       600
     acgcgcgtgc cgggcttcct gtgcgccacc gcggaacaaa ccgccaaggc cgcggtcgag       660
     ggcgtggcgc gcaacaagct ccgggtggcc cccatcgccg cgcacaaggt ccagtccgcg       720
     ctcgcgaact acctcccgag gccgctgtgg gcgagggcca tgtaccgctt ttacggaggc       780
     aagtga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page