(data stored in ACNUC7421 zone)

EMBL: CP001958.PE357

CP001958.PE357       Location/Qualifiers
FT   CDS_pept        complement(341452..341931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96850"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB91"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96850.1"
FT                   /translation="MRVFRADTMPPWWLGALSALGLGAAVASADFPMSRRERFLARAAR
FT                   IAGSAACAGAGAEQLRRAASLPPPIPISQRAGAAIACAASLSTTPLIGERCVDKAARAL
FT                   SARGASWPRARLGALIAATALLGELLQRFPAPPTPKTPPPRRRLVRPNPGTIIRN"
     atgcgcgtgt tccgggccga cacaatgccc ccttggtggc tgggggcgct cagcgcgctc        60
     gggctcgggg ccgctgtcgc ctcggcggac ttcccgatgt cgcggcgtga gcggttcctc       120
     gcccgcgcgg cgcgcatcgc gggctccgcg gcatgcgcgg gcgcgggcgc ggagcaactt       180
     cggcgcgcag cctcgctgcc gcccccgatc ccgatctccc agcgagcagg cgcggccatc       240
     gcatgcgcgg cctcactcag caccaccccg ttgatcggcg agcgctgcgt cgacaaagcc       300
     gctcgggcgc tctccgcccg aggggcgagc tggcccaggg cgcgactcgg cgcgctcatc       360
     gccgccacag cgctgctcgg cgaactgttg caacgtttcc cggccccgcc gaccccgaag       420
     accccgccgc ccaggcggcg gctcgtgcgg ccaaaccccg gaacaataat acgcaactag       480
//

If you have problems or comments...

PBIL Back to PBIL home page