(data stored in ACNUC7421 zone)

EMBL: CP001958.PE359

CP001958.PE359       Location/Qualifiers
FT   CDS_pept        complement(343928..345745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0365"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: nfa:nfa21470 putative ABC transporter; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96852"
FT                   /db_xref="GOA:D6ZB93"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB93"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG96852.1"
FT                   /translation="MNEGMAQTTPGVRALVRLWPYVRPYAGRIGLSLGLVLLSVLTSVC
FT                   IPLMVKHVVDGPIARNDTRGLVWPIVVVSALGLVDAGAIWGRRRVGARPSAELETSMRA
FT                   RVFAHAQRLAIGEHAEWDSGQLLSRGVEDLRQLRRFAAFFGPFFIVNTVAIVATTATML
FT                   VLCWPLGVILIVCEVPMLVATSKLERSWRRVSRQVQDLVGDITTTVEESVLGVRVLKAF
FT                   GAGPGFIARYRAQADELRALELRETRLKASLWMVSGATPVFTVTAMLLVSGWGVAKGQW
FT                   TLGTLVAAISLVMYLNWPLTSIALLLGDLFSTVNAAVRHWELMDRPVSVTDPIRPRALP
FT                   QPVRGELAFEHVGFTYPDAKAPVLTDVSLQLRPGEILALVGPTGSGKSTLANLVPRLLD
FT                   VTSGRITLDGVDIRELRLADLRAQIAVAFEEPVLFSASVRENVALGQPDATDGAVADAL
FT                   EIASAAEFVAKLPWGASTRVGEQGLSLSGGQRQRLALARSVLGQPKVLVLDDPLSALDV
FT                   DTEAQVQAKLRRAVQDSEGAQGAAAPETRPWAPTTLLVAHRPSTAALADRVALLWDGRV
FT                   EAVGSHEELLAASERYRHVMGAIREQADV"
     atgaatgagg gcatggcgca aaccacacct ggtgtcaggg ctctcgtgcg actgtggccg        60
     tacgtccggc cctacgcggg ccggatcggc ctctccttag gtctggtgct gctctccgtg       120
     ctcaccagcg tgtgcatccc gctgatggtc aaacatgtgg tggacggccc gatcgctcgc       180
     aacgacacgc gggggcttgt gtggcccatc gtggttgtgt cggcgttggg gcttgtggac       240
     gcgggtgcga tctggggccg tcgccgcgtc ggagcgcgcc cctccgccga gttggagacc       300
     agcatgcggg cccgagtgtt cgcccatgcg cagcggctcg cgatcgggga gcacgccgaa       360
     tgggactccg ggcaattgct ctcgcgcggc gtggaggacc tgcgccagtt gcgccgcttc       420
     gccgccttct tcggcccgtt cttcatcgtg aacactgtcg ccatcgtggc gaccaccgcc       480
     acgatgctcg tcttgtgctg gccgctgggc gtcatcctca tcgtctgcga agtgccgatg       540
     ctggtggcca cgagcaagct cgaacgctcc tggcgccgcg tctccaggca ggtgcaagac       600
     ctcgtcggcg acatcaccac gaccgtcgag gagtcggtgc tcggcgtccg agtgctcaaa       660
     gcgttcggcg cggggccggg cttcatcgcc cggtaccgcg cgcaagccga cgaacttcgc       720
     gcgctcgaac tgcgcgagac gcggctgaag gcgtcgctgt ggatggtcag cggcgccacg       780
     ccggtgttca ccgtcaccgc gatgctgctc gtgagcggct ggggcgtggc gaaagggcaa       840
     tggacgctcg gcacgctcgt cgccgcgatt tccttggtca tgtatttgaa ttggccgctc       900
     acctccatcg cgctgctgct cggcgacctg ttcagcaccg tgaacgcggc agtccggcac       960
     tgggagctca tggaccggcc ggtctcggtc accgacccga tccgcccgcg cgccttgccg      1020
     cagccggtgc ggggcgaact cgccttcgaa catgtcggct tcacctaccc ggacgcgaag      1080
     gctccggtgc tcaccgatgt gtcgctgcaa ctacggcccg gtgaaatcct cgccctggtc      1140
     ggcccgaccg ggtcgggcaa gagcacgctc gcgaatctcg tgccccgact gctcgacgtc      1200
     acgtcggggc ggatcaccct cgatggcgtg gacatccgcg agctgcgact cgcggacctg      1260
     cgcgcgcaga tcgctgtggc cttcgaagag cctgtgctct tctccgcgag cgtgcgtgag      1320
     aacgtcgccc tcggacagcc cgacgccacc gacggcgcgg tcgccgacgc gctcgagatc      1380
     gcctctgccg ctgagttcgt cgcgaaactt ccgtgggggg ccagcacccg cgtcggcgaa      1440
     caagggctca gcctctccgg gggccaacgc cagcgtctgg ccctcgcgcg atccgtcctc      1500
     ggccaaccga aggtgctcgt gctcgacgat ccgctctccg cgctggacgt ggacaccgag      1560
     gcgcaggtcc aagcgaagct tcgccgggcc gtccaggaca gcgagggcgc gcagggcgcc      1620
     gccgcgccag agacacgccc ctgggcgccg accacattgc tcgttgcgca tcgcccttcc      1680
     accgcggccc tcgccgaccg ggtggcgctg ctctgggacg gacgtgtgga agccgtcggg      1740
     tcccatgagg aactgctggc cgcctccgag cgctaccgcc acgtcatggg cgcgatcagg      1800
     gagcaagccg atgtctga                                                    1818
//

If you have problems or comments...

PBIL Back to PBIL home page