(data stored in ACNUC7421 zone)

EMBL: CP001958.PE365

CP001958.PE365       Location/Qualifiers
FT   CDS_pept        complement(348909..351779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0371"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   Na+/H+ antiporter MnhB subunit-related protein; KEGG:
FT                   rha:RHA1_ro02165 putative monovalent cation/H+ antiporter
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96858"
FT                   /db_xref="GOA:D6ZB99"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB99"
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /protein_id="ADG96858.1"
FT                   /translation="MIEWVFDVLLAHAFAAFLAPALVARWGRQAFLALAFVPAASLAWV
FT                   LSATRGGQVELREHHTWIPQAAMDVDLMLDPLGVIMCLPVLGVGAVVLAYCSRYFAPDE
FT                   PKLGALAGQLTGFAGVMFGLIVSDNTLLLFMFWEITSVLSYLLVGHQGHKLVARRAALR
FT                   ALNITTLGGLAMLVGVIILGEQTGSYLLSEMLRHPVGGALGQTGVALVLVGAFTKSALV
FT                   PWHLWLPGAMAAPTPVSAYLHAAAMVKAGVYLVARLAPAYAHAPVWHWMVLPFGLATAL
FT                   LGGWRALRAWDAKLVLAFSTISQLGLMTMLVGSDSEASRAAGLVMLLAHSLFKAALFMT
FT                   VGGVDRTAGSRHLPKLSRMGPRAAPLVAAAALAGASMAALPPFLGFVGKHAAFDSLLTE
FT                   HAPVWELAPLALLEVAAAALTTGYSLRLSWGLYAHKRGAEPALRPAVALWAPPAILALL
FT                   GLVASFTLPMWSWIVNAAAVGPVFGGDAQTGPSELTAFGQLGAGAALVAVALVIGCGLF
FT                   AVNPNLPKSRRRLGNADEVYDEIMRLLSALALRVTAFVQRGSLPIAQATTLTVLTVFPL
FT                   AMLFSGPRNPIKWHPYDSPFQLVVAVMMMIGAVAAVALTHRIGAVLAAGVTGYGCGVLF
FT                   SLHGAPDLALTQFLVETLTLVVFTLVLRKFDARTNEPIPVFSYAVRIVFSLAVGGALSL
FT                   LALFAISARGAGAPALAGSLAAEGLARAHGSNTVNVIIVDIRAWDTFGEISVLLVAATG
FT                   VASLVFVNRRYGSLPRLAQAPAQAGKQVSWLRSSEFTDPRQRSIILEIATRMVFPTIMT
FT                   LSVYFFFSGHNAPGGGFAGGLVAGLALVLRYLAGGRYELGETLPVEAGKILGAGLALTA
FT                   ATAAGSVLVGLPALSSASVALDLPVLGALRLNTSSLFDLGVYLIVVGMVLDILRSLGAR
FT                   LDEGDDVDAEQPGARPSPAAGAGRPA"
     atgatcgaat gggtgttcga tgtcctgctc gcgcacgcgt tcgcggcgtt cttagcccct        60
     gcgcttgtcg cgcgttgggg gcggcaggcg ttcttggcgc tcgcattcgt ccccgccgcg       120
     agcttggcct gggtgctgtc cgcgacccga ggcggacagg tcgagctgcg agaacaccac       180
     acctggatac cccaagccgc gatggacgtg gacctgatgc tcgacccgct cggggtcatc       240
     atgtgcctgc ccgtgctggg ggtcggcgcg gtggtcctgg cctattgctc ccgctacttc       300
     gccccggacg agccgaaact cggcgccctc gcgggccagc tcaccggatt cgccggcgtc       360
     atgttcggcc tcatcgtcag cgacaacacg ctgctgctgt tcatgttctg ggagatcacc       420
     agcgttctct cgtacctgct ggtcggccat caggggcata agctcgtcgc ccgccgagcg       480
     gcgctgcgcg cgctcaacat cacgaccctc ggcggcctcg ccatgctcgt cggcgtcatc       540
     atcctcggcg aacagacggg aagctacctg ctgtccgaga tgctccgcca tcccgtcggc       600
     ggagccctcg gtcagacggg ggtcgccctc gtgctcgtcg gggcgttcac gaaatcggcg       660
     ctggtgccct ggcacctgtg gctgcccggc gcgatggcgg cgccgacccc ggtcagcgcc       720
     tacctgcacg ccgcggcaat ggtcaaagcc ggggtgtact tggtggcgag gctggccccc       780
     gcgtatgccc acgccccggt gtggcattgg atggtcctgc cgttcggcct cgccacggcg       840
     ctcttgggcg gctggcgcgc gcttcgcgcc tgggacgcga agctcgtgct ggcgttttcc       900
     acgatcagcc agctcgggct catgaccatg ctcgtcggct ccgacagcga ggcgtcccga       960
     gcggcgggcc tggtgatgct gctcgcccac tcgctcttca aggcggcgct gttcatgaca      1020
     gtcggcggcg tcgaccgcac ggcaggcagc cgccacctgc ccaaactctc ccgcatgggc      1080
     ccgagggcgg cgccgctcgt cgcggcggcg gcgctggcgg gggcttctat ggcggctttg      1140
     ccgccttttt tgggtttcgt cggcaaacac gcggcattcg actccttgct caccgagcac      1200
     gccccggtct gggaactcgc cccgctcgcc ctgctcgaag tcgcggcggc ggcgctcacc      1260
     acggggtaca gcctgcgact gagctggggg ctctacgccc acaagcgcgg agccgaaccc      1320
     gccctgcgcc ccgctgtcgc actctgggcc ccgccagcca ttctggccct gctgggcctt      1380
     gtcgcgtcgt tcacgctgcc catgtggtcc tggatcgtca acgccgccgc cgtcgggccc      1440
     gtcttcgggg gcgacgcgca gaccggcccg agcgaactga ccgcgttcgg acagctcggc      1500
     gcgggcgcgg cactggtcgc ggtggctctg gtgatcggct gcggactgtt cgccgtcaat      1560
     cccaacctgc cgaagtcgcg ccggcgcctc ggcaacgccg acgaagtcta cgacgagatc      1620
     atgcgcctcc tgtccgcgct cgcgctgcgc gtgacggcgt tcgtccaacg aggctcgctg      1680
     ccgatcgccc aggccaccac cctcacggtg ctcaccgtct tcccgctcgc catgcttttc      1740
     tccggaccga ggaacccgat caaatggcat ccctacgact cgcccttcca gctcgtcgtc      1800
     gctgtcatga tgatgatcgg ggcggtggcg gcggtggcgt tgacgcacag gatcggggcg      1860
     gtgctcgccg ccggggtcac cggatacggc tgcggggtgc tgttctccct gcacggcgcc      1920
     ccggatctcg cgctcaccca atttctcgtc gagacgctca ccctcgtcgt cttcacgctc      1980
     gtgctgcgca agttcgacgc gcggacgaac gagccgatcc cggtgttctc gtacgccgtg      2040
     cgcatagtgt tctccttggc ggtcggcggc gcgctgtcgc tcctcgcgct gttcgccatc      2100
     agcgcgcgag gcgcgggagc gcctgccctg gcgggttcgc tcgccgcaga agggctcgcg      2160
     cgcgcccacg gcagcaacac cgtgaacgtc atcatcgtgg acatccgcgc ctgggacact      2220
     ttcggcgaga tctccgtcct gctcgtcgcg gccaccggcg tcgcgtcgct ggtcttcgtg      2280
     aaccgccgat acgggtccct cccccggctg gcgcaggccc cggcgcaggc gggcaaacag      2340
     gtgagctggt tgcgctccag cgagttcacc gacccgaggc agcgctcgat catcctggag      2400
     atcgcgaccc ggatggtctt ccccacgatc atgaccctct ccgtgtattt cttcttcagc      2460
     ggccacaacg cgcccggcgg cggcttcgcc gggggcctgg tcgccgggct cgcgctggtg      2520
     ctgcgatatc tcgcgggcgg tcgttatgag ctcggcgaga cactgccggt cgaggccggg      2580
     aaaatcctgg gtgcgggcct cgccctcacc gcggccacgg ccgcgggctc ggtcctcgtc      2640
     ggcctgcccg cgctctccag cgccagcgtc gcgctcgacc tccccgtcct cggggcgctg      2700
     cggctgaaca cctcgagcct tttcgacctg ggcgtctatt tgatcgtcgt cggcatggtc      2760
     ctcgacattt tgcgcagcct cggcgcccgc ctcgacgagg gcgacgacgt ggacgcggaa      2820
     cagccggggg cgcgcccctc cccagccgcc ggagcaggac ggcccgcatg a               2871
//

If you have problems or comments...

PBIL Back to PBIL home page