(data stored in ACNUC7421 zone)

EMBL: CP001958.PE37

CP001958.PE37        Location/Qualifiers
FT   CDS_pept        31483..31845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0037"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_2107 two-component VirA-like
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96530"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9K3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96530.1"
FT                   /translation="MCPAHERQLHRRGEGGLTPLGVPLWKGCVVPGCERRRFGKNMCGL
FT                   HLNRSRKGLPLDPWTRHDEKVYQSALRGVAGVFERRVAVEIEAGECRAEAERKFRVEFQ
FT                   LLASFLDDFAGEGALR"
     ttgtgccccg ctcacgagag gcagcttcac aggcgtggcg agggcgggtt gaccccgctg        60
     ggcgtgccct tgtggaaagg ctgcgtggtg ccggggtgcg agcgcaggcg tttcgggaag       120
     aacatgtgcg ggctgcatct caaccgttcc cgcaagggct tgcccctgga cccttggacc       180
     cggcatgacg agaaggtgta ccagtcggcg ctacggggtg tggcgggtgt tttcgaacgc       240
     cgtgttgcgg tggagattga ggccggggag tgccgcgcgg aggctgagcg gaagttccgc       300
     gtcgagttcc agttgctcgc gtccttcctg gatgacttcg cgggagaggg ggcgctgcga       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page