(data stored in ACNUC7421 zone)

EMBL: CP001958.PE370

CP001958.PE370       Location/Qualifiers
FT   CDS_pept        complement(358386..358859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0376"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: nfa:nfa850 hypothetical protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96863"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA4"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADG96863.1"
FT                   /translation="MQQQALIWQAGRAAFLALLWLFVFAVVRVIRSDIANASGSRVPAQ
FT                   SKSPSSGFFANFGRGRQAKYLVVTRGALRNTRIALGDAPVLIGRADDSTLVVTDEYASS
FT                   RHARLLKRGEDWFVEDLGSTNGTYLDRVKVTAAVRVPLGSPIQVGKTVVELRA"
     atgcagcaac aggcgttgat ctggcaagcc ggacgcgcgg ccttcctggc gcttttgtgg        60
     cttttcgtgt tcgcggtggt ccgtgtgatc cgttcggaca tcgccaacgc gtcaggctcg       120
     cgggtgcccg cgcagagcaa aagccccagc agcggctttt tcgccaattt cggcagaggg       180
     cggcaggcga aatacctggt ggtcacccgt ggcgcgctgc ggaacacgcg gatcgcgctc       240
     ggcgacgcgc ctgtgctcat cggccgggcc gacgattcga cgctggtggt gaccgacgag       300
     tacgcgtcgt cacggcacgc gcgtttgctc aaacgaggag aggactggtt cgtcgaagac       360
     ttgggttcga cgaacggcac ctatctcgac cgggtcaaag tgactgcggc ggtgcgggtg       420
     ccgctcggct cgccgatcca ggtcggcaaa acagtagtcg agctgcgcgc atga             474
//

If you have problems or comments...

PBIL Back to PBIL home page