(data stored in ACNUC7421 zone)

EMBL: CP001958.PE373

CP001958.PE373       Location/Qualifiers
FT   CDS_pept        360806..362431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0379"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mav:MAV_2874 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96866"
FT                   /db_xref="GOA:D6ZBA7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA7"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADG96866.1"
FT                   /translation="MTDAQGNRLAAKISEAMLSTSADLVIMDAETREWSRFPWGEVHAR
FT                   AEAVAADLLDRADGPVGTLGLIGNPTVDIVASVLGAWLAGGSVSLFPGMVRGADLGRWA
FT                   ETTLGRCAQIGVRTIFSYGRELEQLRAVQSGVRTEDVARIGAKPRPQSFVPPRTGDDST
FT                   PAVLQNSSGSTGQPKTAILSRGAFLSNIAAVADRTLLGKEDVVCSWLPLYHDMGLITLV
FT                   SAMWAGAPLWLAPSGAFSAAPLKWLDWITESGATYVKAPNFAYDIIGRYGDKIDRGVDL
FT                   GTLRVAVSAAELIHCDSFERFLAATAPVGFNPGSAMTAYGLAEATCAVAASRPGAGARF
FT                   DDVSVTMPDGGQSRRRYARLGAALDGMRLRIAPPAAPVPAINGREVGEIEVTGACMMNG
FT                   YLGADPIRRDEWFKTGDLGYLLDGELVVVGRFKELIVLAGRNVYPTDIERAAASVEGVR
FT                   AGRVAAVGLDEGGLRPRLALALEYKGSDLDTARRRVVQRVAADCGIVPAEVVFAAPGEL
FT                   PVTTSGKLRRLDVKHMIETGGGLR"
     atgacggacg cgcaaggaaa caggctggcg gcaaagatct ccgaggcgat gctgtccact        60
     tccgccgacc tggtaatcat ggacgccgaa accagggaat ggagccggtt cccctggggg       120
     gaggtgcacg cgcgcgctga ggctgtcgcc gccgacctcc tggacagggc ggacggcccg       180
     gtgggaacgc tcgggttgat cgggaacccc acggtcgaca tcgtggcgag cgtgctcggc       240
     gcctggttgg ccgggggcag cgtgtcgctc ttccccggca tggtgcgcgg cgccgacctg       300
     ggcagatggg ctgagacgac attgggccgg tgcgcgcaga tcggggtgcg cacgattttc       360
     agctacggcc gcgagctgga gcagttgcgc gccgtgcaat ccggcgtccg gaccgaagac       420
     gtcgcgcgca tcggagccaa gccccgcccc caatcctttg tcccgccgcg cacaggggac       480
     gacagcaccc cggcggtgct gcagaactcc tccgggtcca cggggcagcc gaagacggcg       540
     atcttgtccc gtggggcgtt cctgagcaat atcgccgcag tggcggaccg gacgctgttg       600
     ggcaaagaag acgtggtgtg cagctggttg ccgctctacc acgacatggg gctcatcacg       660
     cttgtgtccg cgatgtgggc gggcgcgccg ctgtggctcg cccccagcgg cgcgttttcc       720
     gccgcgccgc tcaaatggct ggactggatc accgagagcg gggcgacgta tgtgaaggcc       780
     ccgaacttcg cgtacgacat catcggcagg tacggggaca agatcgaccg cggtgtggac       840
     ctcggcacgt tgcgggtcgc ggtgagcgcg gcggagttga ttcattgcga cagcttcgaa       900
     cgcttcctcg ccgcgacggc cccggtgggc ttcaacccgg gctccgccat gacggcctac       960
     ggcctggcgg aggcgacgtg cgcggtggcc gcttcccggc ccggagccgg agcgcgcttt      1020
     gacgacgtgt ccgtcaccat gccggacggc ggccagtccc gccgcaggta cgcgcgtctc      1080
     ggcgccgcgt tggacggcat gcgcctgcgc attgcgcccc ccgcggcccc ggtccctgcc      1140
     atcaacggca gagaggtcgg cgaaatcgag gtcaccgggg cgtgcatgat gaacggctac      1200
     ctcggggccg atccgatccg acgtgacgaa tggttcaaga cgggcgatct cggctatctg      1260
     ctcgacggcg agcttgttgt ggtcggccgg ttcaaggaac tcatcgtcct ggccgggcgc      1320
     aacgtctacc ccaccgatat cgagcgcgcg gcggcctcgg tggagggcgt gcgggctggc      1380
     agggtcgcgg cggtcggcct cgacgagggc ggtctgcgcc cgaggctcgc gctcgctctg      1440
     gagtacaagg gctccgacct ggacactgct cgcaggcggg tggtccaacg ggtcgccgcc      1500
     gactgcggga tcgtccccgc ggaggtcgtg ttcgccgccc ctggggagct gccggtcacg      1560
     acttcgggca aattacgtcg gctcgacgtc aagcacatga tcgagaccgg aggaggactg      1620
     cgatga                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page