(data stored in ACNUC7421 zone)

EMBL: CP001958.PE374

CP001958.PE374       Location/Qualifiers
FT   CDS_pept        362428..363603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0380"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   msm:MSMEG_2130 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96867"
FT                   /db_xref="GOA:D6ZBA8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA8"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADG96867.1"
FT                   /translation="MTSVDVSRRAQERLSPEGFQDLLRSVVDDEVRAWVEEAEKDERFP
FT                   RKLIERFGERGVFEDKWASGALPDVAKLVELGFALGGLGSVGISVGVSLHDSAISVLRR
FT                   FGRTDYLREVAESAIRGETLLCIGASEEIGGSDLQISETMVRSHDGGYQINGSKKFVSL
FT                   APVADHIVVVARSADSAPEGQKGNVMLLLVPTAQTAVREPYRKLSAGPLETAWVDIDTW
FT                   VPAEALIARPGAGLAAISWGLSHERLGVAAQIVALCERALGITLARMTDRVQFGSTLIE
FT                   HQALRLRFADLWSRVNMMRYSLAGIAATGEMNLRTAAAVKVTAARLGEEVLSECLHIFG
FT                   GSGYLVDHTPIGRWWRDMKLARVGGGTDETLWEFVATAMKPDVEGYRSLCP"
     atgacaagcg tcgatgtgag ccgcagggcg caagagcggc tgtcgccgga gggattccag        60
     gacttgctgc gctcggtcgt ggacgacgag gtccgggcct gggtcgagga agccgagaaa       120
     gacgagcggt tcccccgcaa gctcatcgaa cggttcggcg agcgcggcgt gttcgaggac       180
     aaatgggcgt ccggggccct tcccgacgtg gcgaaactcg tcgaattggg cttcgcgctg       240
     ggcggactcg gctctgtcgg catcagcgtc ggcgtgagct tgcacgattc ggccatctcg       300
     gtcctgcgcc gattcggcag gaccgactac ctgcgcgaag tcgcggagag cgcgattcgg       360
     ggcgaaacct tgctctgcat cggggcctcc gaggaaatcg gtggttctga cctgcaaatc       420
     tccgaaacta tggtgcgcag ccacgacggc ggctaccaga tcaacggcag caaaaaattc       480
     gtgtcgctcg cgcctgtcgc cgaccacatc gtcgtggtgg cccgcagcgc ggacagcgcg       540
     ccggagggcc aaaaaggcaa cgtcatgctc ttgctggtgc cgacggcgca aactgccgtg       600
     cgcgagcctt accgcaaact cagcgccggg ccgctcgaaa ccgcgtgggt ggacatcgac       660
     acctgggtgc ccgccgaggc attgatcgcc cggcccggcg cgggcctcgc ggcgatcagt       720
     tgggggttgt cccatgaacg gctcggcgtc gcggcgcaaa tcgtcgcgct ctgcgaacgg       780
     gctttaggga tcacgctcgc cagaatgacg gaccgggtgc agttcggcag caccctcatc       840
     gagcatcagg cgctgcggtt gcgtttcgcg gacctgtggt ccagggtcaa tatgatgcgc       900
     tactcgttgg cggggatcgc ggccacgggc gagatgaacc tgcgcacagc cgcggccgtg       960
     aaagtcacgg cggcccggct cggcgaagaa gtgctctccg agtgcctgca tatcttcggc      1020
     ggctcagggt atttggtcga ccacaccccg attggccgct ggtggcggga tatgaagttg      1080
     gcccgcgtgg gcggcggcac ggatgagacg ctttgggaat tcgtcgccac cgcgatgaag      1140
     ccggatgtcg agggctaccg ttccttatgc ccgtag                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page