(data stored in ACNUC7421 zone)

EMBL: CP001958.PE375

CP001958.PE375       Location/Qualifiers
FT   CDS_pept        complement(363727..364467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0381"
FT                   /product="Siderophore biosynthesis protein, conserved
FT                   region"
FT                   /note="PFAM: Siderophore biosynthesis protein, conserved
FT                   region; KEGG: mjl:Mjls_1700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96868"
FT                   /db_xref="GOA:D6ZBA9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA9"
FT                   /inference="protein motif:PFAM:PF10331"
FT                   /protein_id="ADG96868.1"
FT                   /translation="MSPTTLKPAAERSLDAHSELGQAILHRVSRPWPVLYRLIAPDPSV
FT                   PAPPEPNLDPPFAVRRVDPDSEDTAIIAAWMRQPALVRGWEQDWPDERWYDQLKAQVES
FT                   NYSHPYLILFRDKPIGYLECYRPAQDSIGATYAADPHDLGMHGAIADEAMASKGFMVML
FT                   LPRLIKSFFELEPQCRRIMFDPEHKNVETRRVFEHVGCVFLGEHQMPNRRMALYTLPRT
FT                   PADVPESWPLEAEEPAAKTEEQPE"
     atgagtccta cgactctcaa gccggccgca gagagaagcc tcgacgccca ctccgagtta        60
     gggcaggcta tactacaccg cgtgtctcgg ccttggcccg ttctctatcg tctcatcgcc       120
     cccgatccgt ccgtgccggc gccgcccgag ccgaatttgg acccgccgtt cgccgtgcga       180
     cgcgtggacc cggacagcga ggacaccgcg atcatcgccg catggatgcg ccagcccgcg       240
     cttgtgcgcg gctgggaaca ggattggccc gacgagcgct ggtacgacca gctcaaagcg       300
     caggtcgaaa gcaactactc gcatccctac ctgatcttgt tccgcgacaa gccgatcggc       360
     tatctggagt gctaccgccc ggcgcaggac tcgatcggcg ccacatacgc cgccgatccg       420
     cacgacctgg gcatgcatgg cgctatagcc gacgaggcga tggcgagcaa ggggttcatg       480
     gtcatgctcc tgcccaggct catcaaaagt tttttcgagc tcgaaccgca atgccgaagg       540
     atcatgttcg accccgagca caagaacgtg gagacccgcc gggttttcga gcacgtcgga       600
     tgcgtcttcc tcggcgagca tcaaatgccc aaccgcagaa tggcgttgta caccctgccg       660
     cggactccgg ccgacgtgcc cgagtcctgg cccctggaag ccgaagagcc ggcggcgaaa       720
     acggaggagc aacccgaata g                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page