(data stored in ACNUC7421 zone)

EMBL: CP001958.PE378

CP001958.PE378       Location/Qualifiers
FT   CDS_pept        365729..370291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0384"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="KEGG: rop:ROP_35350 glutamate synthase large
FT                   subunit; PFAM: ferredoxin-dependent glutamate synthase;
FT                   glutamine amidotransferase class-II; glutamate synthase;
FT                   glutamate synthase alpha subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96871"
FT                   /db_xref="GOA:D6ZBB2"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBB2"
FT                   /inference="protein motif:PRIAM:1.4.7.1"
FT                   /protein_id="ADG96871.1"
FT                   /translation="MNRSPSPQGLYHPSEEHDSCGVAMIVDIHGRRSHELVAKAIAALV
FT                   NLDHRGAAGAEPNTGDGAGALIQVPDRFLRAVAGFELPEVYATGIAFLPQGGSDAEQAA
FT                   RAVEKIVESEGLATLGWREVPVNDSSIGALARDAMPTFRQIFIADPRGQLDGLDLERRL
FT                   YIVRKRVEHELRWGDERVYFPSLSARTLVYKGMLTTLQLREFYTDLQDERVESAVAIVH
FT                   ARFSTNTFPSWPLAHPYRFIAHNGEINTVAGNSNWMRARESLIRSDVFGGPEAWQKIFP
FT                   IVTPGASDTARFDEVVELLTLAGRPLPHAMLMMVPEAWENNPDMPKAHRDFYRYHASLM
FT                   EPWDGPAAMCFTDGSLVGALLDRNGLRPGRVWVTDDEVMVASEAGAFPVAQEKIIQKTR
FT                   LRPGRMLLVNMAEGRIITDEEVKDELSAAQPYGEWLHEQIALRDLPERETVRMNHERVL
FT                   NRQQVFGYTTEDVNILIKPMAMTGQEGIGSMGTDTPIAALSERPRLLFDYFQQLFAQVT
FT                   NPPLDAIREEIVTSLYGSLGPERDVLNPEPLSCRQVQLEQPILSNDDLARLVAANDDGK
FT                   YPWLRSTVIPGLYPVAKGGDGIAAALDVIRSQASDAIAGGARLIVLSDRNSNESLAPIP
FT                   SLLLTAAVHHHLIREKTRTKIGLIVETGDAREVHHMAALLGCGAAAVNPYLALETLHDL
FT                   VERKLMPGFTYAKAEANYLKATSKGVLKIMSKMGISTLASYTGAQLFQVIGLDQGLVDE
FT                   YFTGLRSQLGGVGLAELAADVGVRHHRAFIERPEERAHRELEVGGEYQWRREGEYHLFN
FT                   PETVFKLQHSTRTGRYDVFKEYTRAVDERAEKIGTLRGLFEFDPRGRAPIPVEEVEPVS
FT                   EIVKRFSTGAMSYGSISAEAHETLAIAMNRLGGRSNSGEGGEDEDRFTPDENGDWRRSA
FT                   IKQVASGRFGVTSHYLANCTDIQIKMAQGAKPGEGGQLPGHKMYPWIAKTRHSTPGVGL
FT                   ISPPPHHDIYSIEDLAQLIYDLKNANPQARIHVKLVSEIGVGTVAAGVSKCHADVVLIS
FT                   GHDGGTGASPLNSLKHAGAPWELGLAETQQTLLLNGLRDRIVVQVDGQMKTGRDVVVAA
FT                   LLGAEEYGFATAPLVVEGCVMMRVCHLDTCPVGVATQNPVLRARFDAKPEFVVNFFEFV
FT                   AQEVRELLASLGFRTLQEAIGQSQHLNTSRALARWSGEKAGKLDLSPILHQPESPFMNQ
FT                   APYCTSKQEHGLEKALDQVLISQARDAIDNGAEVLIESKIGNLNRSVGTMLGYEVTKAH
FT                   GAAGLAEHAITVDFTGIAGNSFAAFVPKGVTLRLRGEANDYVGKGLSGGNVTIRPAEES
FT                   SDRLVAERNIIAGNVVLFGATSGHAFIRGMVGERFAVRNSGATAVVEGIGDHGCEYMTG
FT                   GKVVILGPVGRNFAAGMSGGVAYIYNPDTTLERRVNPEFVNLEDVDGSDQEWLRAILAR
FT                   HVDETGSSVASRALADWETERRNFVKVMPRDYKRVLITIERAKREGRDPNQAIMEATRG
FT                   "
     atgaaccgca gccccagccc gcaagggctt tatcacccat ccgaagagca cgattcctgt        60
     ggcgtggcca tgatcgttga cattcatggc cgccgtagcc acgaattggt cgccaaggcg       120
     atcgccgctc tggtcaattt ggaccatcgt ggcgcggccg gggccgagcc caacaccggg       180
     gacggcgctg gcgcgctcat ccaggtgccg gaccggttcc tgcgcgctgt cgccgggttc       240
     gaactgcccg aggtgtacgc caccggcatc gctttcctgc cccagggcgg ctccgacgcc       300
     gaacaggcgg cgcgggctgt ggaaaagatc gtcgagtccg aaggcctcgc gacgctcggc       360
     tggcgggagg tgcccgtcaa cgactcgtcc atcggcgcgc tggcgcggga cgcgatgccg       420
     acgttccggc agatcttcat cgcggacccg cgtggccagc tcgacggcct ggaccttgag       480
     cggcggctct acattgtgcg caaacgcgtg gagcacgagt tgcgctgggg cgatgagcgg       540
     gtgtacttcc cgagcctttc ggcccgcacg ctggtctaca agggcatgct caccacgttg       600
     cagctgcgcg agttctacac ggacttgcag gacgagcggg tggagtccgc cgtcgccatc       660
     gtgcacgccc ggttctccac gaacaccttc ccctcgtggc cgctcgcgca cccgtaccgt       720
     ttcatcgcgc acaacggcga gatcaacacg gtcgcgggca actccaactg gatgcgcgcg       780
     cgcgagtcgt tgatccgcag cgacgtgttc ggcggcccgg aggcgtggca gaagattttc       840
     ccgatcgtca cgcccggagc ctcggacacc gcccggttcg acgaggttgt ggagctcttg       900
     accctcgctg gccgtccgtt gccgcacgcg atgctcatga tggtccccga ggcgtgggag       960
     aacaacccgg acatgccgaa ggcgcaccgg gacttttacc gctaccacgc ttcgctcatg      1020
     gagccgtggg acggtcctgc ggcgatgtgc ttcaccgacg gttcgctggt cggggcgttg      1080
     ctcgaccgca acggcctgcg tccggggcgg gtgtgggtca ctgacgacga ggtgatggtg      1140
     gcctccgagg ccggggcgtt ccccgtggcg caggagaaga tcatccagaa gacccggctg      1200
     cggccgggca ggatgctctt ggtgaacatg gccgaaggcc ggatcatcac ggacgaagag      1260
     gtcaaagacg agctgtccgc cgcccaaccc tacggggagt ggctgcacga gcagatcgcg      1320
     ttgcgcgact tgcccgagcg cgagacggtg cggatgaacc acgagcgggt gctcaaccgc      1380
     cagcaagtgt tcggttacac cacagaagac gtgaacatcc tcatcaagcc gatggcgatg      1440
     accggacagg aaggcatcgg ctcgatgggc acggacacgc ccatcgccgc gctgtccgag      1500
     cgcccgaggc tgttgttcga ctacttccag cagcttttcg cccaggtgac gaacccgccg      1560
     ctggacgcga tccgcgaaga gatcgtgacg agcctgtacg gttcgctcgg cccggagcgc      1620
     gatgtgctca accccgagcc gctctcgtgc cgccaggtgc agctggagca gccgatcctc      1680
     tcgaacgacg acttggcgag gctggtcgcg gccaatgacg acgggaagta cccgtggctg      1740
     cgttccacgg tgatccctgg cctgtacccg gtggccaagg gcggcgacgg catcgccgcc      1800
     gccctcgacg tgatccgctc ccaggcgtcg gacgcgatcg cggggggcgc gcggctcatc      1860
     gtcctctcgg accggaattc gaacgagtcg ctggccccga tcccgtcgct tctgctcact      1920
     gcggcggtgc atcaccatct gatccgggag aagacccgca ccaagatcgg cttgatcgtg      1980
     gagaccggcg acgcgcgcga ggtgcaccac atggcggccc tgctcggctg cggcgcggcg      2040
     gcggtcaacc cgtacctcgc gttggagacg ttgcacgact tggtcgagcg gaagctgatg      2100
     ccgggcttca cctacgccaa agccgaggcg aactacctga aggcgaccag caagggcgtc      2160
     ttgaagatca tgtccaagat gggcatctcc accctcgcct cctacacggg agcgcagctt      2220
     ttccaggtta tcggcctgga ccagggtttg gtggacgagt acttcacggg tttgcgcagc      2280
     cagctcggcg gggtgggcct cgccgagctg gccgccgacg tcggggtgcg ccaccaccgc      2340
     gctttcatcg aacgccctga ggagcgcgcg caccgcgagc tggaagtcgg cggcgaatac      2400
     caatggcgcc gggaggggga gtaccacctc ttcaacccgg agacggtgtt caagctgcaa      2460
     cactccaccc gcacgggccg ctacgacgtg ttcaaggagt acacccgggc cgtggacgag      2520
     cgggccgaga aaatcggcac gctgcgcggg ctgttcgagt tcgacccgcg cggtcgcgcg      2580
     cccatcccgg tcgaggaggt ggagccggtc agcgagatcg tgaaacggtt ctccaccggc      2640
     gcgatgagct acggctcgat ctccgcggag gcgcacgaga cgctcgcgat cgcgatgaac      2700
     cggctcggcg gtcgctcgaa ctccggcgag ggcggcgagg acgaggaccg gttcaccccg      2760
     gacgagaacg gcgactggcg gcgcagcgcg atcaaacagg tcgcctcggg acggttcggc      2820
     gtgacctcgc actatctcgc gaactgcacc gacatccaga tcaagatggc gcaaggcgcg      2880
     aagcccggcg agggcggaca gctgccaggg cacaagatgt acccgtggat cgcgaagaca      2940
     cggcactcca cgcccggagt cgggctcatc tccccgccgc cgcaccacga catctactcg      3000
     atcgaagacc tcgcgcagct catttacgac ctgaagaacg cgaacccgca ggcgcggatc      3060
     catgtgaaac tcgtttcgga gatcggcgtc ggcacggtcg cggccggggt ttccaagtgc      3120
     cacgccgacg tcgtgctcat ctcgggccat gacggcggca ccggcgcgag cccgttgaac      3180
     tcgctcaagc acgcgggggc cccgtgggag ctcggcctcg ccgaaaccca gcagaccctg      3240
     ttgctcaacg ggctgcggga ccggatcgtg gtccaggtgg acgggcagat gaaaaccggc      3300
     cgcgacgtcg tcgtggcagc gctgctcggg gccgaggagt acggtttcgc caccgcgccg      3360
     ctcgtcgtcg agggctgtgt catgatgcgc gtgtgccacc tggacacgtg cccggtgggc      3420
     gtggcgacgc agaacccggt gctgcgggcc cggttcgacg cgaagcccga gttcgtcgtg      3480
     aacttcttcg agttcgtcgc gcaagaggtc cgcgagcttt tggccagcct cggtttccgc      3540
     accctgcaag aggccatcgg ccaatcgcag cacctgaaca cctcgcgcgc gctggcgcgc      3600
     tggtctggtg agaaagcggg caagctggac ctctcgccga tcctgcacca gccggagtcg      3660
     ccgttcatga accaggcccc gtactgcacc agcaagcagg agcacgggct ggagaaggcg      3720
     ctcgaccagg tgttgatctc ccaggccagg gacgccatcg acaacggcgc cgaagtgctc      3780
     atcgagtcga agatcggcaa cctcaaccgt tccgtgggca ccatgctcgg ctacgaggtc      3840
     accaaggcgc acggcgcggc gggccttgcc gagcacgcca tcaccgtcga cttcaccggg      3900
     atcgcgggca acagcttcgc cgcgttcgtg cccaagggcg tcaccttgcg tttgcgcggg      3960
     gaggcgaacg actacgtcgg caagggcctc tcgggcggga acgtgacgat ccgtccggcc      4020
     gaggagtctt cggaccggct cgtcgccgaa aggaacatca tcgctggcaa cgtggtgctg      4080
     ttcggggcga ccagcggcca cgccttcatc cggggcatgg tgggcgagcg gttcgcggtg      4140
     cgcaactccg gcgcgacagc cgttgtcgaa ggcatcggcg accacggttg cgagtacatg      4200
     accggcggca aggtcgtcat cctcggccca gtcgggcgca acttcgcggc aggcatgtcc      4260
     ggcggcgtcg cctacatcta caacccggac accacgttgg agcgccgggt gaacccggag      4320
     ttcgtgaacc tcgaagacgt ggacggctcc gaccaggagt ggttgcgcgc gattctggcc      4380
     cggcatgtgg acgagaccgg ttcctcggtc gcgtcccgcg cccttgccga ctgggaaacc      4440
     gaacggcgca acttcgtgaa ggtgatgccc agggactaca agcgcgtgct catcaccatc      4500
     gaacgcgcca agcgcgaggg ccgcgacccc aaccaagcga ttatggaggc gactcgtggc      4560
     tga                                                                    4563
//

If you have problems or comments...

PBIL Back to PBIL home page