(data stored in ACNUC7421 zone)

EMBL: CP001958.PE381

CP001958.PE381       Location/Qualifiers
FT   CDS_pept        complement(372770..373567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0387"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: nfa:nfa2180 putative ABC transporter ATP-
FT                   binding protein; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96874"
FT                   /db_xref="GOA:D6ZBP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBP7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG96874.1"
FT                   /translation="MTVSVDLAQAWVEIPIFDAKTRSLKKAVLSKAGGTIAGSSKFPIV
FT                   EALRDITLSLHEGDRIGLVGHNGAGKSTLLRLLAGIYEPTRGTAVVRGRVAPVFDLGVG
FT                   MDPEISGYENILIRGLFLGQTRKSMLRKIKEIAEFSELGDYLDMPMRTYSTGMRIRLAL
FT                   GVVTSIDPEILLLDEGIGAVDADFMKKARERLQALVRRSGILVFASHSNEFLAQFCERA
FT                   LWVDHGSIRMSGGIEEVVTAYEGPAAGASVAHVLANPGWDETP"
     atgactgtgt ccgtcgacct cgcccaagcc tgggtggaga tccccatctt cgacgccaaa        60
     acccgctcgc tcaagaaagc ggtgctcagc aaggcaggcg gcacaattgc cggttccagc       120
     aaattcccca tcgtcgaagc gctgcgcgac atcacgcttt cgctgcacga gggcgaccgc       180
     atcggcctcg tcgggcacaa cggagccggc aagtccacgc tgctgcgtct gcttgccggg       240
     atctatgagc cgacccgggg caccgcggtg gtccgtggcc gcgtggctcc ggtcttcgac       300
     ctcggcgtcg gcatggaccc ggagatctcc gggtacgaga acatcctcat ccgggggctt       360
     ttcctcggcc agacccgcaa gtcgatgctg cgcaaaatca aggagatcgc ggagttctcc       420
     gagctcggcg actatttgga catgccgatg cggacctact ccaccgggat gcgcatccgg       480
     ctcgcgctcg gtgtcgtgac cagcatcgac ccggagatcc tgttgcttga cgagggcatc       540
     ggcgcggtgg acgccgactt catgaagaag gcgcgcgagc gcctgcaagc tctcgtgcgc       600
     cgctcgggca tcctggtgtt cgccagccac tccaacgagt tcctcgccca gttctgcgag       660
     cgcgcgctgt gggtggacca cggcagcatc cgcatgtctg gcggcatcga ggaagtcgtc       720
     acagcatacg aggggcccgc cgccggggcg agcgtcgcac acgtcctcgc gaatcccggc       780
     tgggacgaga ccccctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page