(data stored in ACNUC7421 zone)

EMBL: CP001958.PE382

CP001958.PE382       Location/Qualifiers
FT   CDS_pept        complement(373577..374437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0388"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: rer:RER_02600
FT                   ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96875"
FT                   /db_xref="GOA:D6ZBP8"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBP8"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADG96875.1"
FT                   /translation="MSGTAAEHGFAPARASSRSFSRAWDDLRRGVEGRELWLQLGWQDI
FT                   KQRYRRSVLGPFWITISTGTIAICLALLYSMLLGQDLRDFLPHVTVGLIIWNLIQNSVE
FT                   EGSEVFIVNEGLIKQLPAPISIHIYRLIWRQALLMAHNLVIYVILIAVFPPRHWSWSML
FT                   LAFPALALLLLNAVWVAMVAGVVATRFRDVVPMVSNITQLLFYLTPIVWTTQGLTKQGG
FT                   AVARRARLVEINPLYHYVDILRAPMIGAPQAAYHWWIVIALTAAGFGCMLVVMRQYRSR
FT                   VAYWV"
     atgagcggca cagccgcaga gcacgggttc gccccggcac gggcctcctc ccggtctttc        60
     tcacgcgcct gggacgattt gcgacgcggc gtggaaggcc gcgaactgtg gttgcagctc       120
     ggctggcagg acatcaagca gcgttatcgc cgctcggtgc tcggcccctt ctggatcacg       180
     atctccaccg gcaccatcgc catctgcctg gccctgctgt actccatgct gctgggccaa       240
     gatctgcgcg acttcctccc ccatgtcacc gtgggcctca tcatctggaa cctgattcag       300
     aactcggtcg aggagggctc tgaggtcttc atcgtgaacg aaggcctcat caaacagctc       360
     cccgcgccga tcagcatcca catctaccgg ctcatttggc gccaagccct gctcatggcg       420
     cacaacttgg tcatttacgt cattctgatc gccgtgttcc cgccgaggca ctggtcgtgg       480
     tcgatgctcc tcgccttccc cgcgctcgcc ctgctcctgc tcaacgcggt ctgggtggcg       540
     atggtcgcgg gcgtcgtcgc cacccggttc cgagacgtgg tgccgatggt ctccaacatc       600
     acccagctgc tcttctacct caccccgatc gtctggacca cccaaggact gaccaagcag       660
     ggcggcgcgg tggcccggcg ggcgcggctc gtggagatca acccgctcta ccactatgtg       720
     gacattttgc gcgcgccgat gatcggagcc ccgcaggcgg cgtaccactg gtggatcgtg       780
     atcgccctga ccgcggcggg attcggatgc atgctcgtcg tgatgcggca ataccgctcc       840
     cgcgtcgcgt actgggtgta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page