(data stored in ACNUC7421 zone)

EMBL: CP001958.PE383

CP001958.PE383       Location/Qualifiers
FT   CDS_pept        complement(374557..375027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0389"
FT                   /product="Protein of unknown function DUF2587"
FT                   /note="PFAM: Protein of unknown function DUF2587; KEGG:
FT                   mjl:Mjls_5371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96876"
FT                   /db_xref="GOA:D6ZBP9"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBP9"
FT                   /inference="protein motif:PFAM:PF10759"
FT                   /protein_id="ADG96876.1"
FT                   /translation="MTEENHQSHNIVILDQPHAEDGLDRLVEQPAKVMRIGSMVKQLLE
FT                   EVKGAPLDEASRARLREIHTRSIEELQEGLAPSMREELQRLTLPFTEGETPSEDELRIA
FT                   QAQLVGWLEGLFHGIQTTLIAQQLAARAQVDQSRHEALPPGHSAGPGSGQYL"
     atgaccgagg agaaccacca gtcgcacaac atcgtcattc tcgaccagcc gcacgcggag        60
     gacggcctcg accgactggt cgagcagccc gccaaggtga tgcggatcgg ttcgatggtg       120
     aaacagctcc ttgaagaggt gaaaggcgct ccgctcgacg aggcgtcgcg cgcccggctc       180
     cgtgagatcc acacccggtc catcgaggag ctgcaagaag gactcgcgcc ctcgatgcgc       240
     gaggagctcc aacgcctcac cctcccgttc acggaaggcg agaccccttc cgaggacgag       300
     ctgcggatcg cgcaggccca gctcgtcggc tggctcgaag gcctcttcca cggcatacag       360
     accacgctca tcgcgcagca gctcgccgct cgggcgcagg tcgaccagtc ccggcacgag       420
     gcgctgccgc cggggcacag cgccgggccg ggctccgggc agtatctttg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page