(data stored in ACNUC7421 zone)

EMBL: CP001958.PE384

CP001958.PE384       Location/Qualifiers
FT   CDS_pept        complement(375043..376023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0390"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="KEGG: mgi:Mflv_1189 alcohol dehydrogenase; TIGRFAM:
FT                   NAD(P)H quinone oxidoreductase, PIG3 family; PFAM: Alcohol
FT                   dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96877"
FT                   /db_xref="GOA:D6ZBQ0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ0"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ADG96877.1"
FT                   /translation="MRAIVVPSADGEAMFLAEAPRPEPGPRDVLIEVAAAGVNRADLAQ
FT                   RAGAYPPPPGASQILGLEVAGRIAEIGGEVTDWAVGDEVCALLAGGGYAQYAVAHEACV
FT                   LPVPPGATLAEAAGLPEVAATVWLNLGMIGGLAPGRRVLIHGGGSGVGTHAVQLVRAVG
FT                   AEAAVTASQGKADRCRELGAQIVIDYRTEDFADVLRRRWPDGADLVLDHIGGPYLARDL
FT                   KVLGLDGKILLIASIGGRHAEQIDLGALQLKRASVIGSTLRNRATGGTLGKAAIIAQVR
FT                   EHVWPLIAEGTVKPVLDRTFPLAEAEAAHRALAAGEIFGKTVLLA"
     atgcgcgcga ttgttgtgcc ttccgcagac ggcgaagcca tgttcctggc cgaggctcct        60
     cgtccggagc ccggtccgcg cgacgtgctc atcgaagtcg ccgccgctgg cgtgaaccgg       120
     gccgacctcg cgcagcgcgc tggcgcgtac cctcccccgc ccggagcgag ccagatcctc       180
     gggcttgaag tcgcaggacg gatcgcggaa atcggcgggg aagtcaccga ttgggctgtg       240
     ggcgacgaag tgtgcgccct gttggcaggc ggcggctacg cgcagtacgc cgtcgcgcac       300
     gaggcgtgcg tcctgccggt gccgcccggg gcgacactgg ccgaagcggc tgggctgccc       360
     gaagtcgcgg ccaccgtctg gctcaatctc ggcatgatcg gcggcctcgc gcccggcagg       420
     cgcgtgctga tccacggggg cgggagcggc gtcgggaccc acgctgtcca actcgtgcga       480
     gcagtcggag ccgaggcggc agtgacagcg agccagggaa aggcggaccg gtgccgggag       540
     ctcggggcgc agatcgtcat cgactacaga acagaagact tcgctgacgt gctccggcgg       600
     cgctggcccg acggggcgga cctggtgctc gaccacatcg gcggccccta cttggctcgg       660
     gatctgaaag tgttgggcct ggacggaaaa atcctgctca tcgccagcat cggcggccgt       720
     cacgcggaac agatcgacct gggcgcgctc cagctcaagc gcgcgagcgt catcggctcg       780
     acgctgcgca accgggcgac gggcgggacg ctcggcaagg ccgcgatcat cgcgcaagtg       840
     cgcgagcacg tctggccgct catcgccgag ggcacggtca aaccggtcct tgacaggact       900
     tttccgctcg ccgaggccga ggcggcgcac agagctttag cagcagggga gatcttcggc       960
     aagactgtcc tactggcatg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page