(data stored in ACNUC7421 zone)

EMBL: CP001958.PE385

CP001958.PE385       Location/Qualifiers
FT   CDS_pept        complement(376056..376775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0391"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mav:MAV_1611
FT                   transcriptional regulator, TetR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96878"
FT                   /db_xref="GOA:D6ZBQ1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG96878.1"
FT                   /translation="MQSRTRASSNAKTPRKTAVKKTSAAKKTPAAKKNPASRIPIPKRQ
FT                   RRPTRAEVRKRLLDAALIVFGELGYTAASLDIVAAAAGLTKGAVYSNFSSKDELYFAMI
FT                   EDQLERRVAETNFAASGSADLDEISRFFTSNIFKERHWRLVWLEYWARVVREEELRQPY
FT                   LQARQQFATRIKEAFGPVRENLAKEAAGKKPSVELTEEELATVLLAVNEGLTVQALPDP
FT                   EKYPKELLGKLLRKLLS"
     gtgcaatcac ggacccgggc ctcgtcgaac gcgaagacac cgcgaaaaac cgccgtgaag        60
     aaaacctccg cggcgaaaaa gactcctgcg gcgaagaaga accctgccag ccggattccg       120
     attccgaagc gccagcggcg cccgacgcgc gcggaagtcc gcaaacgcct gctcgacgcc       180
     gcgctgatcg tgttcggcga actgggctac acagccgcgt ccctcgacat cgtcgcggcg       240
     gcggcgggcc tcaccaaagg cgctgtgtac agcaacttct ccagcaaaga cgagctgtac       300
     ttcgccatga tcgaagacca gctcgaacgc cgtgtggccg aaaccaattt cgccgccagc       360
     ggctccgccg accttgatga gatcagccgg ttcttcacct ccaatatttt caaagagcgc       420
     cactggaggc tggtgtggct tgagtactgg gcccgcgtcg tccgcgagga agagctgcgc       480
     cagccctatc tgcaagcccg ccagcagttc gcgacgcgga tcaaggaggc gttcggcccg       540
     gtccgcgaga acctcgccaa agaggctgcc gggaagaaac cttccgtgga gctcaccgag       600
     gaagaactcg cgaccgtcct gctcgcggtc aacgagggcc tgaccgtcca ggcattgccg       660
     gaccccgaga agtacccgaa ggaacttctc gggaagttgc tgcgcaaact gctgtcctga       720
//

If you have problems or comments...

PBIL Back to PBIL home page