(data stored in ACNUC7421 zone)

EMBL: CP001958.PE387

CP001958.PE387       Location/Qualifiers
FT   CDS_pept        378552..379094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfu:PF1233 putative chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96880"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96880.1"
FT                   /translation="MRGTKASRGLVVAAALMFGALGSSLAVADPEPAPAPAVPTAETPT
FT                   MTTETPTPVSPESTAPVPAGTTGGSACAVIRSNKTQIDDATWPLKVATKVEGWDWSGDA
FT                   VEARARIDSQLPQYLANLQEGAKQNDETGSALHDAVEAGHELITTIDHNGDAGDTAGAI
FT                   SAFDKALNDALRSCIQQ"
     atgcgtggaa ccaaggcctc tcgcgggctt gtggtggctg ctgcgttgat gttcggcgcg        60
     ttgggctcgt ccctcgcggt ggcagacccc gagccagccc ccgctccggc cgtgccgaca       120
     gcggagaccc cgaccatgac caccgagacc ccgaccccgg tctcgcccga gtccaccgcc       180
     cccgtccccg ccggcacgac tggcggctcg gcctgcgcgg tgatccggtc caacaagacc       240
     cagatcgacg atgcgacctg gccgctcaag gtcgccacga aggtcgaggg ctgggactgg       300
     agcggcgacg ctgtggaagc tcgtgcccgc atcgacagcc agctccccca atacttggcc       360
     aacctccagg aaggggccaa gcagaacgac gaaaccggca gcgcgctgca tgacgcggtg       420
     gaggcaggcc acgaactgat caccaccatc gaccacaacg gcgacgcggg cgacaccgct       480
     ggcgcgatca gcgccttcga caaggcgttg aacgacgcgc ttcgctcctg catccagcag       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page