(data stored in ACNUC7421 zone)

EMBL: CP001958.PE391

CP001958.PE391       Location/Qualifiers
FT   CDS_pept        381151..382635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0397"
FT                   /product="D-alanyl-D-alaninecarboxypeptidase/
FT                   D-alanyl-D-alanine-endopeptidase"
FT                   /note="KEGG: rer:RER_06180 D-alanyl-D-alanine
FT                   carboxypeptidase; TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D- alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96884"
FT                   /db_xref="GOA:D6ZBQ7"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ7"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ADG96884.1"
FT                   /translation="MEFLARGTIPVPPSAVCAAWAISRYCVDMAPQQRSAPARPKHLAR
FT                   GVVVILVALVVVGVGLWGFQAYQSANAAAPAPAEPSPRSALRPEIRPVSPDAPSPAAAA
FT                   VAAVLDPLGDNPLLARFSGVVLDGVSGAALWQRDPDAAMTPASTMKLLTAASAVLSLPL
FT                   GARLATRVVAGSDPGQVVIVGAGDPTLSAAPDGEQSFYPGAARLDDLVAQVKQHHPGPV
FT                   DEVLVDDSAYEGPNFAQGWLPGDVADGFITPMDPLMLDGGRLDRSRDESPRTTTPALDT
FT                   GKELARRLGADPERTRLAPAPAGAVALAQVQSAPLRERILQFMLASDNVLAEAVGREVA
FT                   RGAGKPASFSGAVAAENEVLGKAGVDLAATRRLDSNGLSLDDRLSARTLARVLALATGR
FT                   SSGLRPLLDMLPVAGATGTLAERFRDPLSGQNTAGAGFVRAKTGSLDDVSTLAGETADQ
FT                   DGRMLVFAFLSNDGATWDTRAALDALASALRGCGCR"
     atggagttct tggcgagagg aacaataccg gtcccgccga gcgcggtgtg cgctgcgtgg        60
     gcgatatcgc gttactgtgt ggatatggca ccgcaacagc gctctgcgcc cgcgcgcccg       120
     aaacacctcg cgcgtggcgt ggtcgtgatc ctggttgcgc tggtggtcgt cggggtcggg       180
     ctgtggggct ttcaggccta ccagtcggcc aacgccgccg cccccgcccc ggctgagccg       240
     tccccccggt ctgcgttgcg gccagagatc cgcccggtct ccccggacgc gccgagcccg       300
     gccgcagccg ccgtcgcggc ggtgttggac ccgctcggcg acaacccgct gttggcgcgg       360
     ttctccggcg tcgtgctcga cggggtgagc ggcgccgcgc tgtggcagcg ggaccccgac       420
     gcggcgatga cccctgcttc gacgatgaag ctgctcacag cggcttcggc ggtgctgagc       480
     ctgcccctgg gcgctcgtct ggcgacgcgt gtggtggccg gctcggaccc ggggcaagtc       540
     gtcatcgtcg gcgcgggaga cccgacgctt tccgcggcgc ccgacgggga gcagtcgttc       600
     taccccggcg cggcgcggct ggacgacctc gtcgcccagg tcaagcaaca ccacccaggg       660
     ccggtggacg aagtgctcgt ggacgattcg gcctacgagg gcccgaattt cgcccaaggc       720
     tggctccccg gcgacgtcgc agacgggttc atcacgccga tggacccgct gatgctggac       780
     ggcggcaggc tggaccggag ccgggacgag tcgccgagga cgacgacccc cgcgctcgac       840
     acgggcaagg agctcgcccg gcgcctcgga gccgacccgg agcggacccg gctcgcgcct       900
     gcccctgcgg gcgcggtcgc attggcgcag gtccaatctg cgccgctgcg cgagcgcatc       960
     ctgcaattca tgctcgcctc ggacaacgtc ctcgcggaag ccgtggggag ggaagtggcg      1020
     cggggcgcgg gcaaaccggc ttccttcagc ggcgcggtcg cggccgagaa cgaggtgctc      1080
     ggcaaggccg gtgtggacct tgccgccacg cggcgcttgg actccaacgg cctttcgctc      1140
     gacgaccgtc tttccgccag gacgctggcg cgggtgctgg ccctggcgac cgggcgctcc      1200
     agcggactgc ggcctttgtt ggacatgctg ccggtcgccg gtgcgaccgg cacgctcgcc      1260
     gagcgcttcc gcgacccgct cagcgggcag aacacggcgg gagccggttt cgttcgggcg      1320
     aagacaggct cgctcgacga cgtgtcgacc ctcgcgggcg agacagcgga ccaggacggc      1380
     aggatgctgg tgttcgcttt cctgtccaac gacggggcca cctgggacac gcgggccgcg      1440
     ctggacgcgc tcgcgtcggc gctgcgagga tgcggctgcc ggtga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page