(data stored in ACNUC7421 zone)

EMBL: CP001958.PE392

CP001958.PE392       Location/Qualifiers
FT   CDS_pept        382620..383612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0398"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="KEGG: nfa:nfa3880 hypothetical protein; TIGRFAM:
FT                   tRNA(Ile)-lysidine synthetase; PFAM: PP-loop domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96885"
FT                   /db_xref="GOA:D6ZBQ8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ8"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ADG96885.1"
FT                   /translation="MRLPVSSPAQPGGVVLWELRKALRAWLAQHAPAQARVCVALSGGA
FT                   DSLALTAALAREHTAVEALVVDHGLQPESAQTAARAAQLALDLGCSGSRVLPVTVNGAG
FT                   GLEAAARTARQAALRQAGAGSPVLLGHTLDDQAETVLLGLARGSGPRSIQGMRAWDDPW
FT                   GRPLLGVRRAMTRAVCAELGVQPHEDPMNTDPRFVRARLRAEVLPLLEDVLQGGVAEAL
FT                   ARTADAVRADNGHLDEEAAAVYAKIGGAKIAVTDVAGLPGPIRRRVLRLWLMGNGAGAL
FT                   TETQIRSVDALASAWRGQGPVAVPAAGPQGGGRRLMARRSYGRLELEIR"
     atgcggctgc cggtgagcag tccggcgcaa cctggcgggg tcgtcttgtg ggagctgcgc        60
     aaggcgctgc gcgcctggct tgcgcagcac gccccggcgc aggcccgcgt gtgcgtcgcg       120
     ctttccggcg gcgcggactc cctcgcgctc accgccgcgc tcgcgcggga gcacacggca       180
     gtcgaagcgc tcgtcgtcga ccacgggctc cagcccgaat ctgcccagac ggctgctcgc       240
     gcggcgcagc tcgcgttgga cctcggctgc tcggggtcgc gcgtgctgcc cgtgaccgtc       300
     aacggcgcag gcggattgga ggccgctgcc cgcacggccc ggcaggcggc gttgcggcag       360
     gctggggccg gttcgcctgt gctgctcggg cacaccctgg acgatcaggc ggagacggtg       420
     ctcctcggcc tcgcccgagg ctcaggccct cggtcgatcc agggcatgcg cgcctgggac       480
     gacccatggg ggcgcccgct gctcggcgtg cggcgcgcga tgaccagggc ggtgtgcgcg       540
     gaactcgggg tccaaccgca tgaggacccg atgaacacgg acccgaggtt cgtccgggcc       600
     cggctgcgcg cagaagtgct gcccctgttg gaggatgtgc tccagggcgg ggtggctgag       660
     gctttggcgc gcacggcgga cgcggtgcgc gcggacaacg gccacctcga cgaggaagcg       720
     gcggcggtct acgccaagat cggcggcgcg aagatcgccg tcaccgatgt ggcgggcctt       780
     ccggggccga tccggcggcg ggtgttgcgg ctgtggctca tgggcaacgg ggccggggcg       840
     ctgaccgaga cgcagatccg ctccgtggac gccttggcgt ccgcctggcg cggccaggga       900
     ccggtggcgg tgccggccgc tggtccgcaa ggcggggggc ggcggttgat ggcgcggcgg       960
     tcgtatggca ggctcgaact tgaaatccga tag                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page