(data stored in ACNUC7421 zone)

EMBL: CP001958.PE393

CP001958.PE393       Location/Qualifiers
FT   CDS_pept        383634..384239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0399"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   KEGG: mjl:Mjls_5161 hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96886"
FT                   /db_xref="GOA:D6ZBQ9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ9"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ADG96886.1"
FT                   /translation="MNESAVAAAPQANWYDADVLSVVLTEEQIAARTTQLAHQIAQNHP
FT                   YRPGQPRSEDLLLVTVLKGAVMFTADLARSLPIPSQLEFMVVSSYGAATKSSGVVRIVK
FT                   DLDRDIRGRDVLVVEDVVDSGLTLSWLLRHLAAREPKSLEVCALLRKPEAQEAPVALDY
FT                   VGFDIPNVFVVGYGLDFDERYRDLPYLGELDPAAVERP"
     atgaacgagt cggctgtcgc cgccgccccg caggccaatt ggtacgacgc cgacgtgctc        60
     tctgtcgtgc tgaccgagga gcagatcgcg gcccgcacca cgcagctcgc gcaccagatc       120
     gcgcagaacc acccgtatcg gcccggccag ccgcgttcgg aagacctgct gctcgtgacg       180
     gtcctgaaag gggcggtgat gttcaccgcc gacctcgcca ggtccctgcc catcccctcg       240
     cagctggaat tcatggtggt gagctcctac ggggcggcca cgaagtcctc tggcgtggtg       300
     cggatcgtca aagacctcga ccgcgacatc cgcggccgcg acgtgctcgt cgtggaggac       360
     gtcgtggatt ctggcctcac tctgtcctgg ctgttgcgcc acctggccgc gcgcgagccc       420
     aagtcgctcg aagtgtgcgc cttgctgcgc aagccggaag cgcaggaagc gccggtcgct       480
     ttggactacg tcggcttcga catccccaat gttttcgtcg tcggatacgg cctcgacttc       540
     gacgagcgct accgggactt gccttacttg ggcgaactcg acccggctgc cgtcgagcgc       600
     ccgtaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page