(data stored in ACNUC7421 zone)

EMBL: CP001958.PE396

CP001958.PE396       Location/Qualifiers
FT   CDS_pept        complement(386014..387285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0402"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="KEGG: gbr:Gbro_0677 molybdenum cofactor synthesis
FT                   domain protein; TIGRFAM: molybdenum cofactor synthesis
FT                   domain protein; PFAM: MoeA domain protein domain I and II;
FT                   molybdopterin binding domain; MoeA domain protein domain
FT                   IV"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96889"
FT                   /db_xref="GOA:D6ZBR2"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBR2"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADG96889.1"
FT                   /translation="MRSVEEHQRRVAELIRAPKPVRLPLGQALGRVLAEDITAQIPLPS
FT                   FDNSAMDGYAARAEDLAGASEQHPVVLPVAADIPAGSPATFALAPQSVHRIMTGACLPP
FT                   GADAILPFESTDRGAEFVRAHAPAKPGAHIRRAGEDLRRGERALAAGARLRAPQIGLIA
FT                   ALGFAEVAVFAPLQVLVLSTGSELTAPGQPLERGRIYESNSPMLAAAVEETGAVAHRLR
FT                   FVPDSVAAFHARIGQALAELGEVDLILTSGGVSAGEYEVVKQAFAEGQTEFGQVEFVSV
FT                   AMQPGKPQGCGVYSPARRAHAESAPPTAGAATALVALPGNPVSAQVSFEVFLREPLAAA
FT                   MGHPRPRRQVLRLPLAEPVPRSPAGKRQFLRGVLAQDRSSVSPFGPPGSHFLRSMALSD
FT                   CLVDIPAGTTSLPEGAEVDVWDLG"
     atgcgatccg tcgaagagca ccagcgccgc gtcgccgagc tgatccgtgc gccaaagccc        60
     gtgcgactgc cgctcggcca agccctcgga cgcgtcctcg cggaggacat aaccgcccaa       120
     ataccccttc cgagctttga taactccgca atggacggat atgcggcccg cgccgaagac       180
     ctcgccggcg ccagcgagca acaccccgtc gtcctccccg tcgccgccga tatccccgcg       240
     ggcagccccg cgacgttcgc gctcgctcct cagagtgtcc acagaatcat gacgggcgcg       300
     tgcctgccgc cgggcgcgga cgcgatcctg cccttcgaat ccaccgaccg aggagccgag       360
     ttcgtgcgcg cccacgcgcc agccaagccc ggcgcccaca tccgccgcgc gggggaagac       420
     ctccgccggg gcgagcgcgc gctcgcggcc ggggcacggc tgcgagcgcc gcagatcggc       480
     ctcatcgccg cgctcggctt cgccgaagtc gccgtcttcg cgcccctgca ggtgctcgtc       540
     ctctccaccg gatctgagct caccgccccg gggcaaccgc ttgagcgggg aaggatctac       600
     gagtccaaca gccccatgct cgccgccgcc gtcgaggaga ccggcgctgt cgcgcaccga       660
     ctgcgcttcg tcccagacag tgtggcggcc ttccacgccc ggatcggcca agcgctcgcc       720
     gaactcggcg aagtggacct gatcctcacc tcgggcggcg tgtccgcggg ggaatacgaa       780
     gtggtcaaac aggccttcgc cgaaggccaa accgagttcg gccaggtcga gttcgtctct       840
     gtcgccatgc aaccgggcaa accacaaggc tgcggcgtgt actccccggc tcgccgagcg       900
     cacgcggaaa gcgccccgcc gacggcgggc gccgccacag cgctggtcgc cctgccaggg       960
     aacccggtct cggcccaggt ctccttcgag gtgttcctgc gcgaaccgct cgccgcggcc      1020
     atgggccatc cccgcccgag gcgccaggtg ctgcggctcc cgctcgccga accagtgccg      1080
     cgctcccccg cgggcaaacg gcaattcctt cgcggggtgc tggcgcagga ccgcagcagc      1140
     gtctcgccgt tcgggccacc aggttcgcat ttcttgcggt cgatggcgct gtccgactgc      1200
     ctcgtggaca tccccgccgg gaccacctcg ctgcccgagg gcgccgaggt cgacgtttgg      1260
     gatttgggct aa                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page