(data stored in ACNUC7421 zone)

EMBL: CP001958.PE406

CP001958.PE406       Location/Qualifiers
FT   CDS_pept        complement(395118..396203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_3921c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96899"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR025859"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBS2"
FT                   /inference="similar to AA sequence:KEGG:MAB_3921c"
FT                   /protein_id="ADG96899.1"
FT                   /translation="MTSTLEPHVNTGAARAAQAIGTTLSTGASQTRAKRIGDREKTAAR
FT                   LLRSSVERSYDAEVDIDWDEPWLPGKLFYPEHRLTLYGTRIWDQLSPEQRVELGKHEMV
FT                   RVFAFGILVEGVLSVMLYRNIAAGNLVDDSTRYMLTEIGDETRHSIMFSRAVNKIGVEP
FT                   ALFPPRITKMIMGIVSNMPLGAWSYGWTLLFEEVLDRLQREAVADDTVQPHLRQLFKIH
FT                   VLEEARHITFAREELVRSYQAAGRVRKGLDRLLVAGATALVAPLTFWPALYRRAFGISA
FT                   FRGFLAVQLSENYRANAQFICEPMIRFFHEAGMIDGWFTKRIWKLSRALPDDVHEDVFG
FT                   EPRKESTPSLFGRILRRLVGA"
     atgaccagca cgctcgaacc gcacgtcaac acgggcgcag cccgcgccgc gcaagctatc        60
     gggaccacgc tctccaccgg agcctcgcag acccgcgcca agcggatcgg cgaccgcgag       120
     aaaaccgccg cgcgcctgct gcgctcgtcg gtggagcgca gctacgacgc cgaagtggac       180
     atcgactggg acgagccgtg gctccctggg aagcttttct acccggagca ccggctcacg       240
     ctctacggca cgaggatctg ggaccagctg tcccccgagc agcgcgtcga actcggcaaa       300
     cacgaaatgg tccgcgtgtt cgccttcggc atcctcgtcg aaggggtgct gagcgtcatg       360
     ctgtaccgca acatcgcggc cggcaacctc gtggacgaca gcacgcgcta catgctcacc       420
     gaaatcggcg acgagacccg ccactcgatc atgttctccc gcgccgtgaa caagatcggg       480
     gtcgagcccg ccctgttccc ccccaggatc actaaaatga tcatgggcat cgtcagcaac       540
     atgcccctcg gcgcatggtc ctacggatgg acgttgctct tcgaagaagt cctcgaccgg       600
     ctgcagcggg aagccgttgc cgacgacacc gtccagccgc acctgcgcca gctcttcaag       660
     atccacgtcc tggaagaggc ccggcacatc accttcgccc gcgaagaact cgtccgcagc       720
     taccaggccg cgggccgagt ccggaaaggt ttggaccggc tgctcgtcgc gggcgcgacc       780
     gcgcttgtgg ctccgctcac cttctggccc gcgttgtacc ggcgcgcatt cggcatctcc       840
     gcgttccgcg ggttcctcgc cgtgcagctc agcgagaact accgggcgaa cgcgcagttc       900
     atctgcgagc cgatgatccg gttcttccac gaggcgggca tgatcgacgg ctggttcacc       960
     aagcggatct ggaaactcag ccgcgcgctg cccgacgacg tccacgaaga cgtcttcggc      1020
     gagccccgca aggaaagcac gccctcgctc ttcggccgaa tcctgcgcag gctcgtgggg      1080
     gcctga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page