(data stored in ACNUC7421 zone)

EMBL: CP001958.PE407

CP001958.PE407       Location/Qualifiers
FT   CDS_pept        396504..397058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbr:Gbro_0370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96900"
FT                   /db_xref="GOA:D6ZBS3"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96900.1"
FT                   /translation="MAEDDPWAVPHTDLAALRAAENAGRRKIWPWVAVATVFVLGLAVG
FT                   AAVLAWFAKDSLDELRSTGKLGQVVYLRAHAYAEQGAANNAETADITYTVVRHLANKSQ
FT                   PQTQTFARTVSLPWEPPTQGTAVDLEGSLVEVVLTVKVPQKSNGNLAGPTCSMSLDNDL
FT                   LDNKTAAGYGNEVTCHWKFSK"
     atggcagaag acgacccttg ggcggtgccg cacaccgatc ttgccgcgct gcgcgccgcc        60
     gagaacgcag gtcggcgcaa aatctggcca tgggtcgcgg tcgcgaccgt gttcgtcctc       120
     ggtttggccg tcggggccgc cgtgctcgcg tggttcgcga aagactccct cgacgagctt       180
     cggtccaccg gaaaactcgg acaagtcgtc tatctgcgcg cgcacgcgta cgcggagcaa       240
     ggcgccgcga acaacgcgga gaccgcggac atcacctaca ccgtggtccg ccatctcgcg       300
     aacaaatccc agccgcagac ccaaaccttc gcccgcaccg tctccctgcc gtgggagccg       360
     ccgacgcaag ggacggcggt ggaccttgag ggctcgctgg tcgaagtcgt cctcaccgtg       420
     aaagtcccgc agaagagcaa cggcaatctc gccgggccga cctgttcgat gagcttggac       480
     aacgacctgt tggacaacaa aaccgccgcg gggtacggca atgaagtgac ctgtcactgg       540
     aagttctcca agtga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page