(data stored in ACNUC7421 zone)

EMBL: CP001958.PE416

CP001958.PE416       Location/Qualifiers
FT   CDS_pept        405392..406249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0422"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; KEGG:
FT                   nml:Namu_0850 dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96909"
FT                   /db_xref="GOA:D6ZBT2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT2"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADG96909.1"
FT                   /translation="MTPALTIMGVLNCTPDSFSGDGLASAPRGAGEAAVRAGLRLVAEG
FT                   ADIVDVGGESTRPGAAQVDPSEQLERILPAVRGLAAAGVFVSVDTCAAAVARAALAQGA
FT                   RMVNDVAGGLCDPELLTAAAEAGAWLVLGHWPGAPARDHGYRPGGTTAALVAQELSERA
FT                   GAALAAGVARDRIILDPGLGFGKNTEENWALIRGVHELRATGFPVLIGASRKRFLGSGL
FT                   PLASGHAEADQAELVWREAGTTAVTALAATLGAWGVRVHAPRPNRAAARAAAEFTGEGA
FT                   HHHG"
     atgacccccg ctctcacgat catgggcgtc ctgaactgca cgccggattc gttctccggc        60
     gacggtctgg ccagcgcgcc gcgaggggcg ggcgaggcgg ccgtgcgcgc aggactgcgc       120
     cttgtcgccg aaggcgcgga catcgtcgat gtcggcgggg agtccactcg gcctggggcc       180
     gcgcaggtcg acccgagcga gcaactggag cggattcttc ccgctgtccg cggcttggcc       240
     gcggccgggg tgttcgtcag cgtggacacc tgcgcggcgg ctgtcgccag ggcggcgctg       300
     gcacagggcg cgcgcatggt gaacgacgtc gctggcggac tgtgcgaccc ggagctgctg       360
     accgccgcgg cggaagccgg cgcgtggctg gtgctcggcc attggcccgg agccccggcc       420
     cgcgaccacg gctatcgccc cggcgggacc acggcggcgc tcgtggcgca agagttgtcc       480
     gagcgggccg gggcggcgtt ggccgccggg gtggcccgtg atcggatcat cctcgaccct       540
     gggctggggt tcgggaagaa caccgaggag aactgggcgt tgatccgagg agtccacgag       600
     ttgcgtgcga caggtttccc cgtgctcatc ggcgcgtccc gcaagcgatt ccttggctcg       660
     gggctcccgc ttgcctctgg gcatgccgag gccgaccagg cagagcttgt ctggcgggag       720
     gcggggacca cagcagtcac cgctctggcg gcgacgctcg gcgcgtgggg cgtgcgtgtg       780
     cacgcgccac gcccgaatcg ggcggcggcg cgtgccgccg cggagttcac cggcgaagga       840
     gcacaccatc atggctga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page