(data stored in ACNUC7421 zone)

EMBL: CP001958.PE418

CP001958.PE418       Location/Qualifiers
FT   CDS_pept        406776..407309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0424"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropter idinepyrophosphokinase; KEGG:
FT                   nfa:nfa4020 putative 2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropteridine pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin- pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96911"
FT                   /db_xref="GOA:D6ZBT4"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT4"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADG96911.1"
FT                   /translation="MTTAVLSLGSNLGNRLGFLQLAVASLGDRVLAASSVYETDPWGTA
FT                   GPNFFNAVLMASDPALDARGWLDEAFRAEALAGRTRETVWGPRTLDVDVIACYDEDGAP
FT                   VVVDEPTLSVPHPRAHQRAFVLVPWLQVQPQARLAVGGEDISVRELIAQLAQAERASVR
FT                   HTPLTLSAFTAHVS"
     atgaccacgg cagtgctttc tctcgggtcc aatctcggca accggctggg ttttttgcag        60
     ctcgccgttg cctcgctcgg cgacagggtg ctcgcggcct cttcggtgta cgagacagac       120
     ccgtggggca cggccggccc gaacttcttc aacgcggtgc tcatggcgtc cgatcctgcg       180
     ctcgacgcgc ggggctggtt ggacgaggcg tttcgggctg aggcgctcgc ggggcgcacg       240
     cgcgagacgg tctgggggcc caggacgctc gatgtggacg tgatcgcctg ctatgacgag       300
     gacggggccc ccgtcgtggt ggacgagcca acgctctcgg tcccgcatcc tcgggcgcat       360
     caacgggcct tcgtgctcgt cccttggctc caggtccagc cgcaggcgcg cttggcggtc       420
     ggcggcgagg acatttcggt ccgcgagctc atcgcccagc tcgcgcaggc cgagcgggcc       480
     tccgtgcgcc acaccccgct cacgttgtcc gcgttcaccg cgcacgtctc atga             534
//

If you have problems or comments...

PBIL Back to PBIL home page