(data stored in ACNUC7421 zone)

EMBL: CP001958.PE42

CP001958.PE42        Location/Qualifiers
FT   CDS_pept        34034..34234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0042"
FT                   /product="23S rRNA m(2)G2445 methyltransferase"
FT                   /note="KEGG: amc:MADE_02010 23S rRNA m(2)G2445
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96535"
FT                   /db_xref="GOA:D6Z9K8"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9K8"
FT                   /inference="similar to AA sequence:KEGG:MADE_02010"
FT                   /protein_id="ADG96535.1"
FT                   /translation="MSGNPIATTRYTVLSGPGSGPTLGELRELVAKTHDWAADSRVLIA
FT                   RSRIDQDDESWHMALLREAGK"
     atgagcggaa acccgatagc gaccacacgc tacaccgttc tctccgggcc ggggagcggc        60
     ccgacgctgg gcgagcttcg cgagctggtc gcgaaaacgc acgactgggc cgcagactcg       120
     cgcgtgctca tcgcccgctc gcggatcgac caggacgacg aaagctggca catggcgctg       180
     ctaagggagg ccgggaaatg a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page