(data stored in ACNUC7421 zone)

EMBL: CP001958.PE421

CP001958.PE421       Location/Qualifiers
FT   CDS_pept        408798..410156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96914"
FT                   /db_xref="GOA:D6ZBT7"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT7"
FT                   /inference="similar to AA sequence:KEGG:MAB_0539"
FT                   /protein_id="ADG96914.1"
FT                   /translation="MTESVAPKRRKASRKGATLSVAYALCFVFAVGASVAVVYTGNDML
FT                   MRFGLVFALWAALGWAFIADQSRRKAELVSAKASDYKLIYDLQLEREIAARHHYELSLE
FT                   GELRRQLTAEADSATHSALAELQQQVALLRGQLQELLDQDLEYDQPALKARATRLDELL
FT                   VAKQSLAPTESQPRKRAAQAQDDAASPRLWLPSQPDQARREQPLVQEPSAPETVVEQEA
FT                   QGSGAQGKEAQEPAAEQWRHDEQQAAWPQQPEAWLQDQRRQPSSLQALVDPEPQERPAG
FT                   WQQPKAPPMAGMEPAAAAGQTVDYPSWYSQSEAAPSAVVEPQQQQQPGAAGQDAGKAPG
FT                   SGRHEQRDAEPQPRSEPSSGKAGKSKHADKADRAKPAESRGGRRAKPAAGEDSSVPAQE
FT                   QSAAADTLAAAHASGHSVNELLSRLSPDEAAGYHGRRRRARAQDAAVSDEDMR"
     atgaccgaat cggtggcccc gaagcggcgg aaggcgtctc gtaagggggc cacgctcagc        60
     gtcgcgtacg cgctctgctt cgttttcgcc gtcggcgcga gtgtcgcagt ggtgtacacg       120
     ggaaacgaca tgttgatgcg gttcggcctc gtgttcgcct tgtgggcggc gctgggctgg       180
     gcgttcatcg ccgaccagtc gcggcgcaaa gccgagctgg tctccgccaa ggcctcggac       240
     tacaagctca tttatgatct gcaactcgaa cgggagatcg cagcgcggca tcattacgag       300
     ctttcgttgg agggcgagtt acgccgacag ctgacggcgg aggcggactc ggcgacccac       360
     agcgcgctcg cggagctcca acaacaagtc gcgttgctgc gagggcagct gcaagagttg       420
     ttggatcagg atctcgaata cgaccagccc gcgttgaaag cgagggcgac caggctcgat       480
     gagcttttgg tggcgaagca gtcgctggcc cccaccgaat cgcaaccgcg caaacgcgcg       540
     gcccaggccc aggacgacgc ggcctcgcct cgtttgtggc tgccgtccca gccggaccag       600
     gcgcgccgcg agcagcccct cgtccaggag ccctccgcgc cggagactgt tgtggaacag       660
     gaagcccagg gcagcggcgc ccagggcaag gaagcgcagg agcctgccgc cgagcaatgg       720
     cgccacgacg aacagcaggc cgcctggccg cagcagcccg aagcctggct tcaggaccag       780
     cggcggcaac caagttcctt gcaagccctc gtcgatccgg agccgcaaga acggcctgct       840
     ggctggcagc agccgaaagc gcctcctatg gcggggatgg aaccagccgc ggcggccggg       900
     cagacggttg actacccgag ctggtactcc caatcggaag cggccccgtc cgctgtcgtg       960
     gagccacagc agcagcaaca gccgggagcc gcgggccagg acgccggcaa agcccctggc      1020
     tccggcaggc acgaacagcg cgacgcggag ccgcagccgc gatcagaacc ctcgagcggc      1080
     aaagccggga agtccaagca cgcggacaag gctgacaggg ccaagcccgc cgagtcgcgc      1140
     ggcggccgca gggccaagcc ggcggcgggc gaggactcct cggtcccggc gcaggagcag      1200
     agcgcggcgg cggacacgtt ggccgcggcc catgcctccg ggcattccgt caacgaactg      1260
     ctctcacggc tcagcccgga cgaggccgcc ggataccatg gtcggcgcag acgagccagg      1320
     gcgcaggacg cagccgtgtc ggacgaggac atgcgctga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page