(data stored in ACNUC7421 zone)

EMBL: CP001958.PE422

CP001958.PE422       Location/Qualifiers
FT   CDS_pept        410236..411108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0428"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="TIGRFAM: pantoate/beta-alanine ligase; KEGG:
FT                   svi:Svir_35550 pantothenate synthetase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96915"
FT                   /db_xref="GOA:D6ZBT8"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT8"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ADG96915.1"
FT                   /translation="MSLGHTGPVLCHSPQQLRELADRLRAVGKHIALVPTMGALHHGHL
FT                   ALVEHAKRLPHATVVASVFVNPLQFGQGEDFERYPRPLAADLEALRQKKVRVVYTPAPA
FT                   AMYPLDGGGTQVVPGPLADELEGALRPGHFTGVLTVVMKLLAACGATWAVFGEKDYQQL
FT                   TLIRQMIRDLDLPVSAIGVPTVREEDGLALSSRNVYLSPHERQQAAGLSAALRAGAAEG
FT                   ERGPDAVLGAARATLEGYPGLAVDYLELRDPDLRQCPQRGPARLLVAARCGTTRLIDNM
FT                   PVSLGDGGR"
     atgtctctcg gccataccgg cccagtgctg tgccacagcc cgcagcagtt gcgcgagctt        60
     gccgaccggc tgcgagcggt cggcaagcac attgccctgg tccccactat gggagcgctg       120
     caccacgggc atctggcgct ggtcgaacac gccaagcgcc tgccgcacgc cacagtggtg       180
     gcctcggtct tcgtcaatcc gctgcaattc ggccagggcg aggacttcga gcgttacccg       240
     aggccgctcg ccgccgacct cgaagcgctc cggcagaaga aagtccgcgt ggtctacacc       300
     ccggcccccg ccgcgatgta cccgctggac gggggcggca cccaggttgt ccccggcccg       360
     ctcgccgacg agctcgaagg agcgctccgg cccggtcatt tcacgggggt gctgaccgtc       420
     gtgatgaagt tgctcgcggc gtgcggcgcg acctgggccg tgttcggcga gaaagactac       480
     cagcagctca cgctgatccg gcagatgatc cgcgacctcg acctcccggt gtccgccatc       540
     ggcgtcccca cagtgcgcga ggaggacggc ctggcccttt cgtcgcgcaa cgtgtacttg       600
     agcccgcatg agcgccagca agccgcaggg ctttcggcgg ccctgcgcgc cggagcggcc       660
     gagggcgagc gaggccctga cgcggtcctc ggcgcggccc gcgcgacgct ggagggctac       720
     cctggcctcg ccgtggacta cctggaactt cgagaccccg acctgcgcca gtgcccgcag       780
     cgcggaccgg cgcggttgct tgtggctgcc cggtgcggca cgacccggct catcgacaac       840
     atgccggtct cgctcggcga cgggggacgc tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page