(data stored in ACNUC7421 zone)

EMBL: CP001958.PE431

CP001958.PE431       Location/Qualifiers
FT   CDS_pept        419760..420581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0437"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   mab:MAB_1897c high-affinity nickel- transporter NicT"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96924"
FT                   /db_xref="GOA:D6ZBU7"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU7"
FT                   /inference="protein motif:PFAM:PF03824"
FT                   /protein_id="ADG96924.1"
FT                   /translation="MLHFGVLVTALLLGVRHAFDGDHITAIDNVVRRLVAKGRSARTVG
FT                   TWFALGHSAVVFLMAVATVAGAKFAGSLLDEHSPARRALGLFGSLASVVFLLVLGLMNL
FT                   RVLVAAFQGRERQPGGWLLQRAQLVTQPWQMFFVGFLFGLGFDTASEIALLVLAGAAAA
FT                   SGASVWLALAIPVCFAAGMTFFDTLDGWLMGYAYRGALRDERAARWYNIAITGLSVFLA
FT                   LGVGTVELVGLIAGEDIVDLEHVGYVAVALFFALWAGWFLLAARRRNPVEL"
     atgctgcatt tcggcgtgct cgtgaccgcg ttgctcctcg gcgtccggca cgccttcgac        60
     ggcgaccaca tcaccgcgat cgacaacgtt gtccgtcggc ttgtggccaa agggcgcagc       120
     gcgcggacag tcgggacctg gttcgcgctc ggccactccg cagtggtgtt cctcatggcg       180
     gtggccaccg tggccggggc gaagttcgcg ggttcgctgc tcgatgagca ttcccccgcc       240
     cggcgtgcgc tcgggctctt cggttccctc gcctccgtcg tgttcctcct cgtcctgggc       300
     ctgatgaacc tgcgtgtgct tgtcgctgcc ttccagggac gagagcgcca gccgggcggc       360
     tggctgctcc aacgcgccca actcgtcacg cagccgtggc agatgttctt cgtgggcttc       420
     ctgttcggcc tcgggttcga caccgcgtcg gagatcgcgc ttttggtgtt ggccggggcc       480
     gccgccgcga gcggggcctc ggtgtggctg gcccttgcga tcccggtgtg cttcgccgcc       540
     ggtatgacgt tcttcgacac cctcgacggc tggctgatgg gctacgccta ccgcggcgct       600
     cttcgcgacg agcgcgccgc gcggtggtac aacatcgcga tcacgggtct ttccgtgttc       660
     ttggccctcg gcgtcggcac ggtcgagctg gtcgggctga tcgcgggcga ggacatcgtc       720
     gatctggagc acgtcggcta cgtcgcggtc gcgctgttct tcgcgctctg ggcgggatgg       780
     tttctcctcg ccgcgcgccg ccgaaatcca gtagagttgt ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page