(data stored in ACNUC7421 zone)

EMBL: CP001958.PE432

CP001958.PE432       Location/Qualifiers
FT   CDS_pept        420583..421941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0438"
FT                   /product="domain of unknown function DUF1731"
FT                   /note="PFAM: domain of unknown function DUF1731; NAD-
FT                   dependent epimerase/dehydratase; KEGG: sen:SACE_4096
FT                   nucleoside-diphosphate sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96925"
FT                   /db_xref="GOA:D6ZBU8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU8"
FT                   /inference="protein motif:PFAM:PF08338"
FT                   /protein_id="ADG96925.1"
FT                   /translation="MRYKVSSVVQAPPEEVFAWFAAPGAAQRLTPPWSGVRFEREADDL
FT                   ADGRAVLRLPLGARWTAEHDPAGFVPGRQFVDEASSFPVRQLTGGWRHVHTFTPVGDGA
FT                   TLVGDEVSSFAPGRVLRPVFAFRHRQLAGDLAALRRARAWRDAQAPPLTVAVTGSGGTV
FT                   GQALSALLTTSGHRVVKLVRRGPRHPGERRWDVDEPAADLLDGVDVVVHLAGESIAGRF
FT                   DAEHRRAVFDSRVGPTRKLAERVAGSKSTSALVCASAVGVYGADRGDLALDEDAERGDG
FT                   FLAEVVVAWESACAPAKEAGTRVAHIRTGVVQSGQGGVLRLLWPLFWLGLGGKLGDGAQ
FT                   WLAWIALDDLVDIYRRAVVDEDLRGPVNAVAPQPVRNAAYTKALADVLGRFAVLPVPKF
FT                   GPRLLLGAEGAAELAFASQRVVPARLQKLGHTFRYPAIREALAHELGRETPPE"
     gtgcgttata aggtcagcag tgttgtccag gctccgccgg aggaggtctt cgcgtggttc        60
     gccgcgcccg gagccgccca acgcctgacg ccgccatggt cgggcgtgcg gttcgagcgg       120
     gaagccgacg acctggcaga cggccgggcg gtgctgcggc tccctctcgg cgcgcgttgg       180
     accgcggaac acgacccagc gggctttgtc cccggtcggc agttcgtgga cgaagccagc       240
     tccttccccg tccgccagct caccggcgga tggcggcacg tccacacctt cacgccggtc       300
     ggcgacggcg cgaccttggt cggcgacgag gtgtccagct tcgcccccgg ccgtgtgctg       360
     cggccggtgt tcgctttccg ccaccgccag ctcgccgggg acctcgccgc gttgcgccgc       420
     gcgcgggcct ggcgcgacgc ccaggccccg ccgctcaccg tcgcggtcac cggttcgggc       480
     ggcaccgtcg ggcaagccct gtccgcgctg ctcaccacct cggggcatcg ggtcgtcaaa       540
     ctggtccggc gcggcccgcg acaccccggc gagcgccgct gggatgtgga cgagcccgcg       600
     gcggacctcc tcgacggggt cgacgtcgtc gtccatttgg cgggcgagtc gatcgcgggc       660
     cgtttcgacg ccgaacaccg ccgcgccgtg ttcgacagcc gggtcgggcc cacccggaaa       720
     ctggccgaac gtgtggcggg ttcgaagtcc acgagcgcgc tggtctgcgc gtccgcggtc       780
     ggtgtgtacg gggcggatcg cggcgacctc gcgctggacg aggacgcgga gcggggcgac       840
     ggctttttgg ccgaggtcgt cgtggcctgg gaatcagcgt gcgcgcccgc caaggaggcg       900
     ggcacgcggg tggcgcatat ccggaccggc gtggtgcagt ccgggcaagg cggcgtgctg       960
     cgcctgctgt ggccgttgtt ctggctcggc ctcggcggaa agctcggcga cggcgcgcaa      1020
     tggttggcgt ggatcgcgct cgacgacctg gtcgacatct accggcgcgc ggttgtggac      1080
     gaggatctgc gcggcccggt caacgcggtc gcgccgcagc cggtccgcaa cgcggcgtac      1140
     accaaggcgt tggccgacgt cctcggcagg ttcgccgtcc tgccggtgcc gaaattcggg      1200
     ccgaggctgc tcctcggagc cgaaggggcc gctgagctgg cgttcgcgag ccagcgtgtc      1260
     gttccggccc gactccagaa actcggccac acgttccgtt accccgccat ccgagaagcc      1320
     ctcgcccatg agttggggcg agagacgccg cccgaatga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page